Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate WP_013532097.1 MESCI_RS21685 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_2050 (263 letters) >NCBI__GCF_000185905.1:WP_013532097.1 Length = 254 Score = 258 bits (658), Expect = 1e-73 Identities = 132/252 (52%), Positives = 176/252 (69%), Gaps = 4/252 (1%) Query: 8 SNTQPLLDIRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQG 67 S +P++++RG RK +G +EVLKG+ LS+ RG +V +IG SGSGK+TLLR +N LE Sbjct: 2 STQRPMVEVRGARKSFGAVEVLKGIGLSVDRGQIVAIIGPSGSGKSTLLRSINHLESLDS 61 Query: 68 GQIMLDGESIGYDDIDGKRVRHPEKVIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLKV 127 G++ LDG + RH KV R GM FQ FNLFPHLT ++N+++G + + Sbjct: 62 GEVWLDGVQVNQKLHGHAFERHINKV----RQQMGMVFQHFNLFPHLTVIENISMGPIIL 117 Query: 128 KKLPKDEAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTS 187 K + K +A ALA L +VGL ++ D +P +LSGGQ+QRVAIARA+AM P +MLFDE TS Sbjct: 118 KGMTKSDAHALAHSLLSKVGLADKIDAYPSRLSGGQKQRVAIARALAMQPKVMLFDEATS 177 Query: 188 ALDPELVGEVLNVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFE 247 ALDPELV EV V+K LA + MTML+VTHEMRFA EV+D+++FM+ G I E+GPP ++F Sbjct: 178 ALDPELVDEVNAVMKQLAAEHMTMLIVTHEMRFAGEVADRVLFMDGGVIVEEGPPGDMFR 237 Query: 248 RPQSPRLAEFLK 259 PQ R FLK Sbjct: 238 APQKDRTRSFLK 249 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 254 Length adjustment: 24 Effective length of query: 239 Effective length of database: 230 Effective search space: 54970 Effective search space used: 54970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory