Align BztA, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_013530400.1 MESCI_RS12995 amino acid ABC transporter substrate-binding protein
Query= TCDB::Q52663 (338 letters) >NCBI__GCF_000185905.1:WP_013530400.1 Length = 344 Score = 240 bits (612), Expect = 4e-68 Identities = 131/338 (38%), Positives = 194/338 (57%), Gaps = 7/338 (2%) Query: 3 KSVFFGSVALA------ALVAGAASASTLDDVKARGQLICGSNPG-LTGFAAPDANGVYQ 55 K++ +G+ A+A A A AA TL+ VKARG L C + G GFA D G ++ Sbjct: 2 KTMKWGAAAMALGLVHFAAPAEAAGGKTLEAVKARGVLNCTGHDGSYLGFAEVDDKGNWK 61 Query: 56 GFDVAVCKAVAAAVLGDPMKVKYVPLTGETRFTALASGEVDVLVRNSTWTFSRDTELALD 115 G D+ +C+AVA AVLGDP K+K VP++ R+ +L SG+VD++++ S T SRDTEL L Sbjct: 62 GMDIDLCRAVATAVLGDPAKLKVVPISWAQRWPSLQSGDVDIIIKASGGTLSRDTELGLQ 121 Query: 116 FVAVNYYDGQGFMVNKSLGVSSAKELDGATICVQTGTTTEMNLADFFKANNMTYTPVNIA 175 F Y M +K L + S K+ G TIC+ GT+ E +A + + PV I Sbjct: 122 FSMSYYLGTTKVMAHKELNLKSLKDAAGGTICIPAGTSQEQQVAAYTAKLGIKLEPVLIE 181 Query: 176 DDAEGQQKFAAGACDSYTTDASGLASSRATLPNAADIVILPEIISKEPLGPVVRHGDNNW 235 E +Q + +G CD Y LA +R D VILP++++ EP ++R GD+NW Sbjct: 182 KTEELEQAYFSGRCDLYAQWGPTLAIARIAKSKVDDHVILPDVLAVEPEVMIMRQGDDNW 241 Query: 236 GDIVRWSFYALVAAEEYGITKANLEEVAASTQNPEIRRLLGLEGDMGKKIGLDNDFAKRA 295 DI W+ L+ AE+ GIT N++EV A +P++ + LG+ MGK +GLD+D+A + Sbjct: 242 VDIANWTLSTLIFAEQEGITSKNVDEVKAKPTSPQVAKFLGVTPGMGKGLGLDDDWAYKV 301 Query: 296 ILASGNYGEVFEANIGASTSIGLARGLNAQWTQGGLMY 333 I GNYGE+FE ++G + + R L W GG+++ Sbjct: 302 IKNVGNYGEIFERDLGKDSPYKMDRELTNLWNNGGVLF 339 Lambda K H 0.316 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 344 Length adjustment: 29 Effective length of query: 309 Effective length of database: 315 Effective search space: 97335 Effective search space used: 97335 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory