Align BztA, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_013532423.1 MESCI_RS23340 amino acid ABC transporter substrate-binding protein
Query= TCDB::Q52663 (338 letters) >NCBI__GCF_000185905.1:WP_013532423.1 Length = 342 Score = 373 bits (958), Expect = e-108 Identities = 187/332 (56%), Positives = 240/332 (72%), Gaps = 5/332 (1%) Query: 11 ALAALVAGAASASTLDDVKARGQLICGSNPGLTGFAAPDANGVYQGFDVAVCKAVAAAVL 70 A L+A AASA+TLD VKA+G + CG + GL GF+APD G +QG D C+AVAAAV Sbjct: 12 ATLGLMASAASAATLDTVKAKGFIQCGVSTGLAGFSAPDDKGDWQGIDADFCRAVAAAVF 71 Query: 71 GDPMKVKYVPLTGETRFTALASGEVDVLVRNSTWTFSRDTELALDFVAVNYYDGQGFMVN 130 GD +VK+ PL+ + RFTAL SGE+D+L RN+TWT +RDT L L+F+ V YYDGQGFM+N Sbjct: 72 GDGSRVKFTPLSAKERFTALQSGEIDILSRNTTWTINRDTALGLNFIGVTYYDGQGFMIN 131 Query: 131 --KSLGVSSAKELDGATICVQTGTTTEMNLADFFKANNMTYTPVNIADDAEGQQKFAAGA 188 K GV+SA +L GA +CVQ+GTTTE+NLAD+FKAN M Y PV E + AG Sbjct: 132 AKKLPGVNSALQLSGAAVCVQSGTTTELNLADYFKANKMEYNPVVFEKLEEVNAAYDAGR 191 Query: 189 CDSYTTDASGLASSRATLPNAADIVILPEIISKEPLGPVVRHGDNNWGDIVRWSFYALVA 248 CD YTTD SGL R TL + AD V+LPEIISKEPLGP VR GD+ W IV+W+++AL+ Sbjct: 192 CDVYTTDQSGLYGIRLTLGSPADHVVLPEIISKEPLGPAVRQGDDQWYHIVKWTYFALLQ 251 Query: 249 AEEYGITKANLEEVAASTQNPEIRRLLGLEGD--MGKKIGLDNDFAKRAILASGNYGEVF 306 AEE GITKAN++E+ S +PEI+R+LG E D +G +G+ ND+ + A GNYGE+F Sbjct: 252 AEELGITKANVDEMKNSA-SPEIKRVLGQEADTKIGTDLGVSNDWVVNIVKAVGNYGEMF 310 Query: 307 EANIGASTSIGLARGLNAQWTQGGLMYAPPFR 338 E N+G+ + + +ARG+NA WT+GGL YAPP R Sbjct: 311 ERNVGSGSPLKIARGINALWTKGGLQYAPPIR 342 Lambda K H 0.316 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 342 Length adjustment: 28 Effective length of query: 310 Effective length of database: 314 Effective search space: 97340 Effective search space used: 97340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory