Align GluC aka CGL1952, component of Glutamate porter (characterized)
to candidate WP_013527987.1 MESCI_RS00570 amino acid ABC transporter permease
Query= TCDB::P48244 (228 letters) >NCBI__GCF_000185905.1:WP_013527987.1 Length = 224 Score = 85.1 bits (209), Expect = 1e-21 Identities = 69/221 (31%), Positives = 113/221 (51%), Gaps = 18/221 (8%) Query: 10 PSLLPAFWVTIKLTIYSAIGAMIFGTILTTMRVSPVKILRTLSTAYINTVRNTPLTLVVL 69 P+LL F T+ L I S + G ++ +R+ K LR L+ Y + R P+ +V++ Sbjct: 18 PALLRGFLNTLLLGILSIGIGIPIGLGISLVRLYAPKPLRWLAVGYTDIFRALPVLVVLI 77 Query: 70 FCSFGLYQNLGLTLAGRESSTFLVDNNFRLAVLGFILYTSTFVAESLRSGINTVHFGQAE 129 + L LG+ L+ S AV F S + AE RSGI ++ GQ E Sbjct: 78 LIYYAL-PFLGIRLSSWAS-----------AVTAFAFIMSAYSAEVFRSGIESIPRGQFE 125 Query: 130 AARSLGLGFGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVGEASLLMKATIE 189 A+++LGL F T R ++ PQA+R I P+ + +++ K+T++AS + + E LL +AT Sbjct: 126 ASQALGLPFLLTLRKVVLPQAIRVVIPPMTSNCVSMFKDTSLASTVALPE--LLKEATNA 183 Query: 190 N--HANMLFVVFAIFAVGFMILTLPMGLGLGKLSERLAVKK 228 +AN ++ A A+ ++I PM + L ER +K Sbjct: 184 QSLYANPSPLIGA--ALVYLIFLWPMVRLVSLLEERFKTEK 222 Lambda K H 0.327 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 224 Length adjustment: 22 Effective length of query: 206 Effective length of database: 202 Effective search space: 41612 Effective search space used: 41612 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory