Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_013532097.1 MESCI_RS21685 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >NCBI__GCF_000185905.1:WP_013532097.1 Length = 254 Score = 182 bits (461), Expect = 1e-50 Identities = 102/247 (41%), Positives = 148/247 (59%), Gaps = 10/247 (4%) Query: 1 MIEFHDVHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGG 60 M+E K++ + L+ L++ GQI +IG SG+GKSTLLR IN LE G Sbjct: 7 MVEVRGARKSFGA----VEVLKGIGLSVDRGQIVAIIGPSGSGKSTLLRSINHLESLDSG 62 Query: 61 RILVEGEDVTA-----LDAEGLRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSR 115 + ++G V + + RQ++GM+FQHFNL TV +NI+M + G ++ Sbjct: 63 EVWLDGVQVNQKLHGHAFERHINKVRQQMGMVFQHFNLFPHLTVIENISMGPIILKGMTK 122 Query: 116 AEVDARVSELLARVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQ 175 ++ A LL++VGL+D YP++LSGGQKQRV IARALA +P ++L DEATSALDP+ Sbjct: 123 SDAHALAHSLLSKVGLADKIDAYPSRLSGGQKQRVAIARALAMQPKVMLFDEATSALDPE 182 Query: 176 TTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQH 235 V ++ ++ E +T++++THEM V D+V MDGG IVE+G D+F PQ Sbjct: 183 LVDEVNAVMKQLAAE-HMTMLIVTHEMRFAGEVADRVLFMDGGVIVEEGPPGDMFRAPQK 241 Query: 236 PTTRRFV 242 TR F+ Sbjct: 242 DRTRSFL 248 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 254 Length adjustment: 26 Effective length of query: 309 Effective length of database: 228 Effective search space: 70452 Effective search space used: 70452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory