Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_013529094.1 MESCI_RS06155 ATP-binding cassette domain-containing protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_000185905.1:WP_013529094.1 Length = 518 Score = 430 bits (1105), Expect = e-125 Identities = 216/296 (72%), Positives = 249/296 (84%), Gaps = 8/296 (2%) Query: 3 SPVTNTMS--DDTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCI 60 +PV S +D +L+V+HLSMKFGGL+AI D SF AKRG+ITALIGPNGAGKTTVFNCI Sbjct: 4 NPVQKAASGMNDAILQVDHLSMKFGGLVAIGDLSFAAKRGEITALIGPNGAGKTTVFNCI 63 Query: 61 TGFYKPTMGMITFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQ 120 TGFYKP+ GMIT N+ G +LLERLP+ I A+VARTFQNIRLFSG+T+LENLLVAQ Sbjct: 64 TGFYKPSEGMITLNRNDGSTFLLERLPNHEIPARAKVARTFQNIRLFSGMTLLENLLVAQ 123 Query: 121 HNKLMKASGYTILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRL 180 HNKLMKASGYT+LGL G Y++ +AE++ELA+ WLEKADL+DRADDPAGDLPYGAQRRL Sbjct: 124 HNKLMKASGYTVLGLFGFSGYRKASAESVELAKHWLEKADLVDRADDPAGDLPYGAQRRL 183 Query: 181 EIARAMCTGPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISD 240 EIARAMCTGPELLCLDEPAAGLNP+ESA LN LL I+ +G SILLIEHDMSVVM+ISD Sbjct: 184 EIARAMCTGPELLCLDEPAAGLNPKESAALNELLIDIKNTSGASILLIEHDMSVVMQISD 243 Query: 241 HVVVLEYGQKISDGTPDHVKNDPRVIAAYLGVEDEEVEEVIA------AVEQLEGG 290 HVVVLEYG+KISDG+P V+ DPRVIAAYLGV+DEEVE V+ +EQL+ G Sbjct: 244 HVVVLEYGRKISDGSPQSVRTDPRVIAAYLGVDDEEVEAVLTEVGDEDVIEQLDTG 299 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 518 Length adjustment: 30 Effective length of query: 262 Effective length of database: 488 Effective search space: 127856 Effective search space used: 127856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory