Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_013529095.1 MESCI_RS06160 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_000185905.1:WP_013529095.1 Length = 242 Score = 276 bits (707), Expect = 2e-79 Identities = 142/234 (60%), Positives = 178/234 (76%), Gaps = 1/234 (0%) Query: 1 MLQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRY 60 +L + V T+YG I+AL+ V+V V+QGEIV LIGANGAGKSTL+MT+ G+P+A +G+I + Sbjct: 6 LLDIKGVQTYYGNIRALNGVDVTVKQGEIVALIGANGAGKSTLMMTIFGAPRARAGTITF 65 Query: 61 MGEELVGQDSSHIMRKSIAVVPEGRRVFARLTVEENLAMGGFFTDKGDYQEQMDKVLHLF 120 G ++ + I R IA PEGRR+F R+TV ENL MG + Y E ++KV LF Sbjct: 66 AGTDITQMPTHEIARMRIAQSPEGRRIFPRMTVMENLQMGASLDNLKHYDEDVEKVFTLF 125 Query: 121 PRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFDIIEQL- 179 PRLKER TQRGGT+SGGEQQML+IGRALM++PKLLLLDEPSLGLAP+I++QIFD I +L Sbjct: 126 PRLKERITQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKQIFDAIRELN 185 Query: 180 RKDGVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLTDPKVREAYLGG 233 R G+TVFLVEQNA ALK+A R YV+ NG V M GTG+ LL +P+VR AYL G Sbjct: 186 RTQGLTVFLVEQNAFGALKLATRGYVMVNGNVTMSGTGKELLANPEVRAAYLEG 239 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 242 Length adjustment: 23 Effective length of query: 210 Effective length of database: 219 Effective search space: 45990 Effective search space used: 45990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory