Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_013529094.1 MESCI_RS06155 ATP-binding cassette domain-containing protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000185905.1:WP_013529094.1 Length = 518 Score = 176 bits (446), Expect = 9e-49 Identities = 104/260 (40%), Positives = 154/260 (59%), Gaps = 12/260 (4%) Query: 17 SLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVL 76 ++L LS FGGL A+ K G IT LIGPNGAGKTT+FN ++ F +P +G + Sbjct: 16 AILQVDHLSMKFGGLVAIGDLSFAAKRGEITALIGPNGAGKTTVFNCITGFYKPSEGMIT 75 Query: 77 FNGDS-----IGQLAPHQIALRGSV-RTFQVAKVLSRLTVLENMLLADQHQ----TGEKF 126 N + + +L H+I R V RTFQ ++ S +T+LEN+L+A ++ +G Sbjct: 76 LNRNDGSTFLLERLPNHEIPARAKVARTFQNIRLFSGMTLLENLLVAQHNKLMKASGYTV 135 Query: 127 LPRLINFRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPK 186 L L F +K + E A LE L +A D AG L G ++ LE+ARA+ + P+ Sbjct: 136 L-GLFGFSGYRKASAESVELAKHWLEKADLVDRADDPAGDLPYGAQRRLEIARAMCTGPE 194 Query: 187 LILLDEPAAGVNPTLIGQICEHIVN-WNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNL 245 L+ LDEPAAG+NP + E +++ N G + L+IEH+M V+M + HV VL GR + Sbjct: 195 LLCLDEPAAGLNPKESAALNELLIDIKNTSGASILLIEHDMSVVMQISDHVVVLEYGRKI 254 Query: 246 ADGTPEQIQSDPRVLEAYLG 265 +DG+P+ +++DPRV+ AYLG Sbjct: 255 SDGSPQSVRTDPRVIAAYLG 274 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 518 Length adjustment: 30 Effective length of query: 237 Effective length of database: 488 Effective search space: 115656 Effective search space used: 115656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory