Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_013532981.1 MESCI_RS26210 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000185905.1:WP_013532981.1 Length = 265 Score = 245 bits (625), Expect = 8e-70 Identities = 130/254 (51%), Positives = 172/254 (67%) Query: 12 GSPESSLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPD 71 G + +L A+ + + FGGL AV+ VK G I GLIGPNGAGKTT+F+LL+ I P Sbjct: 9 GETRAPVLTARNVVRRFGGLVAVNDVSFNVKAGEILGLIGPNGAGKTTMFDLLAGSILPT 68 Query: 72 QGEVLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLI 131 GE+L NG + A H RG RTFQ+ + L LT++EN++LA Q Q GEK L + Sbjct: 69 SGEILLNGARVSGEAAHLRIGRGLGRTFQIPRPLPNLTLIENIMLAAQGQAGEKLLANFV 128 Query: 132 NFRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLD 191 RV +ERA R KA+ +LE V L A + A LSGGQRKLLE+AR +M++P +ILLD Sbjct: 129 TPWRVAAQERAARTKALELLELVALAHLAHEPARVLSGGQRKLLELARVMMADPAIILLD 188 Query: 192 EPAAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPE 251 EPAAGVN TL+ I + I + N +GITFL+IEHN+D++ LCH V V+A G+ L++GT E Sbjct: 189 EPAAGVNATLLEVIIDRIRDINARGITFLLIEHNIDMVTRLCHRVLVMASGQLLSEGTAE 248 Query: 252 QIQSDPRVLEAYLG 265 ++ DPRV+EAYLG Sbjct: 249 EVARDPRVIEAYLG 262 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 265 Length adjustment: 25 Effective length of query: 242 Effective length of database: 240 Effective search space: 58080 Effective search space used: 58080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory