Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_013525177.1 MESCI_RS31055 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >NCBI__GCF_000185905.1:WP_013525177.1 Length = 303 Score = 251 bits (641), Expect = 1e-71 Identities = 135/302 (44%), Positives = 201/302 (66%), Gaps = 7/302 (2%) Query: 8 LQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLDS 67 +QQLVNGL VGS YALIA+GY+MV+G+I ++NFAHG++YM G+++ I + + + + + Sbjct: 7 IQQLVNGLIVGSFYALIALGYSMVFGVIKLLNFAHGDIYMNGAFVGLIVFSFVGIW-VGN 65 Query: 68 VPLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNAVMLSQDS 127 L ++ A S++V G IER AYRP+R RL LI+A+G S+ L + Sbjct: 66 GWLGVVCALLVSMLVVGLLGVVIERFAYRPMRNAPRLSILITALGASMVLNGTALALTGG 125 Query: 128 KEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRACRACA 187 + A T L F ++ V I+Y Q+++ + +M G+ F+SR+ G+A RA + Sbjct: 126 RHYAFNTDLG----FAGIDISTVHITYTQMVLVAASIALMAGMQAFVSRTMYGKAMRAVS 181 Query: 188 EDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKAFTAAVL 247 D+ + L+GI+ + +IALTF +G+ALAA V+ G YG ++ +GF+ G+KAFTAAV+ Sbjct: 182 IDMGASRLMGIDVDRVIALTFFMGSALAAGGGVMAGAYYGSVHFFMGFIMGLKAFTAAVI 241 Query: 248 GGIGSIPGAMLGGLLLGVAEAFGADV--FGDQYKDVVAFGLLILVLLFRPTGILGRPEVE 305 GGIGS+PGAMLGGLLLG+ EAFG+ + G +++DV FG LIL L+F+PTG+LGR VE Sbjct: 242 GGIGSVPGAMLGGLLLGLLEAFGSSLPFVGSEWRDVFVFGTLILFLVFKPTGLLGRSVVE 301 Query: 306 KV 307 +V Sbjct: 302 RV 303 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 303 Length adjustment: 27 Effective length of query: 280 Effective length of database: 276 Effective search space: 77280 Effective search space used: 77280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory