GapMind for catabolism of small carbon sources

 

Protein WP_013554576.1 in Nitratifractor salsuginis DSM 16511

Annotation: NCBI__GCF_000186245.1:WP_013554576.1

Length: 453 amino acids

Source: GCF_000186245.1 in NCBI

Candidate for 9 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-asparagine catabolism glt hi Sodium:dicarboxylate symporter (characterized, see rationale) 52% 99% 444.5 The dicarboxylate (succinate, fumarate, malate and oxaloacetate):H+ symporter, DctA (probably 3H+ are transported per succinate taken up 33% 248.4
L-aspartate catabolism glt hi Sodium:dicarboxylate symporter (characterized, see rationale) 52% 99% 444.5 The dicarboxylate (succinate, fumarate, malate and oxaloacetate):H+ symporter, DctA (probably 3H+ are transported per succinate taken up 33% 248.4
L-glutamate catabolism gltP hi Sodium:dicarboxylate symporter (characterized, see rationale) 52% 99% 444.5 The dicarboxylate (succinate, fumarate, malate and oxaloacetate):H+ symporter, DctA (probably 3H+ are transported per succinate taken up 33% 248.4
L-malate catabolism dctA lo The dicarboxylate (succinate, fumarate, malate and oxaloacetate):H+ symporter, DctA (probably 3H+ are transported per succinate taken up (characterized) 33% 95% 248.4 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter 44% 305.1
fumarate catabolism dctA lo The dicarboxylate (succinate, fumarate, malate and oxaloacetate):H+ symporter, DctA (probably 3H+ are transported per succinate taken up (characterized) 33% 95% 248.4 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter 44% 305.1
succinate catabolism dctA lo The dicarboxylate (succinate, fumarate, malate and oxaloacetate):H+ symporter, DctA (probably 3H+ are transported per succinate taken up (characterized) 33% 95% 248.4 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter 44% 305.1
L-serine catabolism sstT lo Serine/threonine transporter SstT; Na(+)/serine-threonine symporter (characterized) 30% 94% 155.6 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter 44% 305.1
L-threonine catabolism sstT lo Serine/threonine transporter SstT; Na(+)/serine-threonine symporter (characterized) 30% 94% 155.6 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter 44% 305.1
L-alanine catabolism SLC1A4 lo neutral amino acid transporter B(0) (characterized) 32% 52% 151.8 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter 44% 305.1

Sequence Analysis Tools

View WP_013554576.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MAEKKKMSLTVKVLIGMALGIIVGLALNMLGLNAHGSWINLYITDGLFLIIGKLFVAALK
MLVVPLVIFSLITGVVGIGDIRELGKVGAKSFVLYMLTTAIAIAVAITIAASLGIGSGVH
MSSDAVFTAKEAPPLSQVLINIVPTNMIDAMAKGNMLQIIFFSILIGISILMVGKKAKAI
VELTEIGNEIMMKMVTIIMALAPYAVFALLARAMANLGLGLLADLAGYVLVLIGTLMFHL
FITLMLLLKLLSGKSPAMFLKKFREVQVFAFSTSSSNATIPVTLRATVERLGVHNSIASF
TIPFGATINMDGTAIMQGVATVFIANAYGVDLGTAGYLTVILMSVLASIGTAGVPGVGLI
MLSMVFTQVGLPVEGIGLILGVDRLLDMIRTAVNVSGDGVVTTIVAKSEKKLDERIYDDP
EAGTVYDEELEIDEKVEEELAKVIEEVKEEEEL

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory