Align PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate WP_013553508.1 NITSA_RS02765 ABC transporter ATP-binding protein
Query= TCDB::Q88NY5 (256 letters) >NCBI__GCF_000186245.1:WP_013553508.1 Length = 237 Score = 114 bits (286), Expect = 1e-30 Identities = 77/207 (37%), Positives = 112/207 (54%), Gaps = 17/207 (8%) Query: 14 ISIKNVNKWYG----DFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKCVNALEPFQKGD 69 I ++N+ K +G +VL + S EVKKGE + PSG+GK+TL+ + +E G Sbjct: 6 IRVENLTKIFGKGDAQVRVLENASLEVKKGEFAALVAPSGAGKTTLLMMIGCVEKPTSGK 65 Query: 70 IVV--------DGTSIADPKTNLPKLRSRVGMVFQHFELFPHLTITENLTIAQRKVLGRS 121 I + D SI DP+ R ++G +FQ L P L I EN+ + G Sbjct: 66 IWLGDELVWDEDHWSIRDPRKIR---REKLGFIFQAHYLIPFLNILENVILIPT-TNGIP 121 Query: 122 EAEATKKGLALLDRVGLSAHAKKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDP 181 A KK + LLD + A P QLSGGQ QR AIARAL+ DP ++L DEPT+ALD Sbjct: 122 RKAAEKKAMELLDYFDIGDKAHAMPSQLSGGQNQRAAIARALSNDPHIVLADEPTAALDM 181 Query: 182 EMVSEVLDVMVQLAQE-GMTMMCVTHE 207 V+ ++ ++A+E + ++ VTH+ Sbjct: 182 SRAVNVVKMLRKIAKERQVAIIMVTHD 208 Lambda K H 0.319 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 237 Length adjustment: 24 Effective length of query: 232 Effective length of database: 213 Effective search space: 49416 Effective search space used: 49416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory