Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_013553109.1 NITSA_RS00740 ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000186245.1:WP_013553109.1 Length = 345 Score = 128 bits (322), Expect = 1e-34 Identities = 81/226 (35%), Positives = 124/226 (54%), Gaps = 7/226 (3%) Query: 33 GQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIVDGIELTSDLKN 92 G FH L I+L++ G + GPSG+GKST++R I LE Q G+I+ G E++ Sbjct: 12 GSFH-LGPIDLSLPAGAAHALLGPSGAGKSTLLRMILGLETPQKGRILFKGEEISHRAVE 70 Query: 93 IDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAMYYLEKVKIPEQAQ 152 G + QH LFPHL++ ENL + RK E + ++ I Sbjct: 71 ----ERGFGYLPQHLALFPHLSVEENLRYG-LKARKRSGAGYETHLKHLIDATGIAPLLD 125 Query: 153 KYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDTMIQLAE-EGMTML 211 + P LSGG++QRVA+ R+L KP+++L DEP SALDP + +E+ L E +G ML Sbjct: 126 RRPETLSGGERQRVALVRALAPKPELLLLDEPFSALDPALRRELWHLTRSLQEIDGTAML 185 Query: 212 CVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQFL 257 +TH+M A A+A+R+ + DG I ++ P + +P +T ++L Sbjct: 186 IITHDMQEAFALADRLHLIIDGTIRQEGTPTQLWEHPHDAQTARYL 231 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 345 Length adjustment: 27 Effective length of query: 236 Effective length of database: 318 Effective search space: 75048 Effective search space used: 75048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory