Align GluC aka CGL1952, component of Glutamate porter (characterized)
to candidate WP_013554635.1 NITSA_RS08635 amino acid ABC transporter permease
Query= TCDB::P48244 (228 letters) >NCBI__GCF_000186245.1:WP_013554635.1 Length = 384 Score = 80.1 bits (196), Expect = 6e-20 Identities = 64/213 (30%), Positives = 100/213 (46%), Gaps = 14/213 (6%) Query: 29 GAMIFGTILTTMRVSPVKILRTLSTAYINTVRNTPLTLVVLFCSFGLYQNLGLTLAGRES 88 GA + G + + + + R T P+ L + GL L +AGR Sbjct: 172 GAWMIGAAIVAAIIGIIFVHRWAKKRQEETGEQFPVFLTGIILLIGL-PLLAYLIAGRPV 230 Query: 89 STF---LVDNNFR---------LAVL-GFILYTSTFVAESLRSGINTVHFGQAEAARSLG 135 + L NFR LA+L +YT+TF+AE++RSGI V GQ EAA SLG Sbjct: 231 TAVYPELHGFNFRGGKTFTPEFLALLFALSIYTATFIAEAIRSGIEAVPKGQKEAATSLG 290 Query: 136 LGFGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVGEASLLMKATIENHANML 195 L R +I PQAVR AI + N + L KN+++A+ IG E + T N Sbjct: 291 LSPLQQLRLVILPQAVRIAIPSIINQYLNLIKNSSLAAAIGYPELVTIFAGTSLNQTGQA 350 Query: 196 FVVFAIFAVGFMILTLPMGLGLGKLSERLAVKK 228 + I + +++++L + L L + ++ +K+ Sbjct: 351 LEILLITMLTYLLISLIVSLILNWFNAKMKIKE 383 Score = 36.2 bits (82), Expect = 9e-07 Identities = 15/52 (28%), Positives = 31/52 (59%) Query: 19 TIKLTIYSAIGAMIFGTILTTMRVSPVKILRTLSTAYINTVRNTPLTLVVLF 70 T+ ++ + + + + G ++ R+SP ++ ++ AYI T RN P+ L +LF Sbjct: 82 TLIVSFWGIVFSSLIGLLIGIWRLSPNWLINRIAAAYIETFRNIPVLLQILF 133 Lambda K H 0.327 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 228 Length of database: 384 Length adjustment: 26 Effective length of query: 202 Effective length of database: 358 Effective search space: 72316 Effective search space used: 72316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory