Align GluD aka CGL1953, component of Glutamate porter (characterized)
to candidate WP_013554635.1 NITSA_RS08635 amino acid ABC transporter permease
Query= TCDB::P48245 (273 letters) >NCBI__GCF_000186245.1:WP_013554635.1 Length = 384 Score = 81.3 bits (199), Expect = 3e-20 Identities = 46/116 (39%), Positives = 74/116 (63%), Gaps = 1/116 (0%) Query: 102 FAAVVFGLTMYNGSVIAEILRSGIASLPKGQKEAAIALGMSSRQTTWSILLPQAVAAMLP 161 F A++F L++Y + IAE +RSGI ++PKGQKEAA +LG+S Q ++LPQAV +P Sbjct: 252 FLALLFALSIYTATFIAEAIRSGIEAVPKGQKEAATSLGLSPLQQLRLVILPQAVRIAIP 311 Query: 162 ALISQMVIALKDSALGYQIGYIEVVRSGIQSASVNRNYLAALFVVALIMIVLNFSL 217 ++I+Q + +K+S+L IGY E+V + S+N+ A ++ ++ L SL Sbjct: 312 SIINQYLNLIKNSSLAAAIGYPELV-TIFAGTSLNQTGQALEILLITMLTYLLISL 366 Score = 43.9 bits (102), Expect = 5e-09 Identities = 23/74 (31%), Positives = 40/74 (54%) Query: 15 PFINSQTWTTYILPGLWGTLKSAVFSVILALVMGTALGLGRISEIRILRWFCAVIIETFR 74 PF + T GL TL + + ++ + ++G +G+ R+S ++ A IETFR Sbjct: 64 PFTPASTHLKVFEVGLLNTLIVSFWGIVFSSLIGLLIGIWRLSPNWLINRIAAAYIETFR 123 Query: 75 AIPVLILMIFAYQM 88 IPVL+ ++F Y + Sbjct: 124 NIPVLLQILFWYNV 137 Lambda K H 0.323 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 273 Length of database: 384 Length adjustment: 28 Effective length of query: 245 Effective length of database: 356 Effective search space: 87220 Effective search space used: 87220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory