Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate WP_013554635.1 NITSA_RS08635 amino acid ABC transporter permease
Query= uniprot:B2TBJ8 (250 letters) >NCBI__GCF_000186245.1:WP_013554635.1 Length = 384 Score = 71.2 bits (173), Expect = 3e-17 Identities = 42/128 (32%), Positives = 73/128 (57%), Gaps = 1/128 (0%) Query: 97 YMCAVLSLALCTAGYTAEIIRGGLMAVPVGQIEAGYSIGLSGFALLRRVIGPIALRQCLP 156 ++ + +L++ TA + AE IR G+ AVP GQ EA S+GLS LR VI P A+R +P Sbjct: 252 FLALLFALSIYTATFIAEAIRSGIEAVPKGQKEAATSLGLSPLQQLRLVILPQAVRIAIP 311 Query: 157 AYSTEAVLLVKSTALASLVTVWE-VTGVAQQIIQQTYRTTEVFICAALIYLFLNFVIVRL 215 + + + L+K+++LA+ + E VT A + QT + E+ + L YL ++ ++ + Sbjct: 312 SIINQYLNLIKNSSLAAAIGYPELVTIFAGTSLNQTGQALEILLITMLTYLLISLIVSLI 371 Query: 216 LGMLETRL 223 L ++ Sbjct: 372 LNWFNAKM 379 Score = 47.8 bits (112), Expect = 3e-10 Identities = 23/54 (42%), Positives = 33/54 (61%) Query: 22 TLGLFFCSLILGGLLSLVIVTMRVSPHWLPNRFARAYILVFRGSPLLIQMFLVY 75 TL + F ++ L+ L+I R+SP+WL NR A AYI FR P+L+Q+ Y Sbjct: 82 TLIVSFWGIVFSSLIGLLIGIWRLSPNWLINRIAAAYIETFRNIPVLLQILFWY 135 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 250 Length of database: 384 Length adjustment: 27 Effective length of query: 223 Effective length of database: 357 Effective search space: 79611 Effective search space used: 79611 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory