Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_013553508.1 NITSA_RS02765 ABC transporter ATP-binding protein
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_000186245.1:WP_013553508.1 Length = 237 Score = 133 bits (335), Expect = 4e-36 Identities = 73/209 (34%), Positives = 117/209 (55%), Gaps = 12/209 (5%) Query: 2 TTIRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTS 61 T IRVENL+KIF KG +V+ ++N S+ + G ++ PSG GKTT L +I +E+PTS Sbjct: 4 TGIRVENLTKIFGKGDAQVRVLENASLEVKKGEFAALVAPSGAGKTTLLMMIGCVEKPTS 63 Query: 62 GYIYFDNE--------AVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAK 113 G I+ +E ++ PR++ + + +FQ L P + + +N+ Sbjct: 64 GKIWLGDELVWDEDHWSIRDPRKI----RREKLGFIFQAHYLIPFLNILENVILIPTTNG 119 Query: 114 VPKDKIENKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNL 173 +P+ E K E+ + + + P +LSGGQ QR AIARAL DP ++L DEP + L Sbjct: 120 IPRKAAEKKAMELLDYFDIGDKAHAMPSQLSGGQNQRAAIARALSNDPHIVLADEPTAAL 179 Query: 174 DAQIRESARALVRKIQRERKLTTLIVSHD 202 D + ++RKI +ER++ ++V+HD Sbjct: 180 DMSRAVNVVKMLRKIAKERQVAIIMVTHD 208 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 237 Length adjustment: 26 Effective length of query: 345 Effective length of database: 211 Effective search space: 72795 Effective search space used: 72795 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory