GapMind for catabolism of small carbon sources

 

Protein WP_013644688.1 in Methanobacterium lacus AL-21

Annotation: NCBI__GCF_000191585.1:WP_013644688.1

Length: 348 amino acids

Source: GCF_000191585.1 in NCBI

Candidate for 72 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 40% 71% 190.7 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-proline catabolism opuBA med BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 40% 73% 185.7 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 36% 95% 218.8 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 36% 95% 218.8 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 34% 93% 216.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 37% 89% 216.1 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 37% 88% 212.2 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 35% 96% 209.9 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 86% 209.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 86% 209.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 86% 209.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 86% 209.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 86% 209.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 86% 209.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
sucrose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 86% 209.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 86% 209.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-mannitol catabolism mtlK lo MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 34% 95% 206.1 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 37% 78% 205.7 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 83% 201.4 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 83% 201.4 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 83% 201.4 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 36% 85% 196.8 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 95% 194.9 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 95% 194.9 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 95% 194.9 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 33% 97% 194.9 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 95% 194.9 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 38% 94% 193.7 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 35% 85% 193.7 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 35% 79% 190.7 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 34% 80% 188.7 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 32% 87% 188 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 37% 81% 186.4 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 35% 77% 186 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 32% 96% 184.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 33% 87% 183.3 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 98% 182.2 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 98% 182.2 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 98% 182.2 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 98% 182.2 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 38% 74% 182.2 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 98% 182.2 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 98% 182.2 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 98% 182.2 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 98% 182.2 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 94% 181.4 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 94% 181.4 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 94% 181.4 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 94% 181.4 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 94% 181.4 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 94% 181.4 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 36% 77% 179.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 36% 77% 179.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 32% 85% 178.7 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 31% 97% 177.6 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 35% 60% 161.8 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 36% 80% 153.3 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 31% 95% 152.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtM (characterized) 35% 100% 151 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 35% 85% 149.4 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 37% 77% 132.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-cellobiose catabolism cbtD lo CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) 30% 71% 125.9 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 31% 66% 120.2 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-isoleucine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 31% 89% 102.8 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-leucine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 31% 89% 102.8 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-phenylalanine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 31% 89% 102.8 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-valine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 31% 89% 102.8 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-arginine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 84% 100.1 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-glutamate catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 84% 100.1 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-histidine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 84% 100.1 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
D-alanine catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 30% 87% 95.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9
L-proline catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 30% 87% 95.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 48% 335.9

Sequence Analysis Tools

View WP_013644688.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIKIEHLSKDWKEFKINDVTLEINEDEYFVFLGPSGSGKTMLLELIAGMWTPDSGKIYIN
NQDVTNFPPEKRGVGFVYQNYMLFPHKTVFENIAFGLNIRKVDKKKIEEQVGEMMDLFGI
SHLAHRLPRTLSGGEQQRTALARALIIRPKVLLMDEPLSALDRITREELIREFKKIHEEF
NITIIQVTHNFDEALQLAERIAIIKQGTVSQVGSTDEVFRRPKDEFVADFVGTENIIRGV
ATDGEENLTSVDTGNIVVESTEHKTGKVHFTIRPEAITVSTSRITTSARNEFKGKLTEIY
DLGTIIKLTVDVGEQFVLVLTRQSFDDLELNIGKEVFISFKATAVNLF

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory