GapMind for catabolism of small carbon sources

 

Protein WP_013644846.1 in Methanobacterium lacus AL-21

Annotation: NCBI__GCF_000191585.1:WP_013644846.1

Length: 222 amino acids

Source: GCF_000191585.1 in NCBI

Candidate for 12 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtM (characterized) 41% 91% 153.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 44% 192.2
L-asparagine catabolism bgtA med ATPase (characterized, see rationale) 41% 82% 152.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 44% 192.2
L-aspartate catabolism bgtA med ATPase (characterized, see rationale) 41% 82% 152.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 44% 192.2
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 36% 90% 146.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 44% 192.2
L-histidine catabolism hisP lo Histidine transport ATP-binding protein HisP (characterized) 36% 91% 146 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 44% 192.2
L-lysine catabolism hisP lo Histidine transport ATP-binding protein HisP (characterized) 36% 91% 146 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 44% 192.2
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 36% 67% 145.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 44% 192.2
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 37% 85% 142.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 44% 192.2
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 37% 90% 140.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 44% 192.2
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 37% 90% 140.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 44% 192.2
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 35% 83% 132.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 44% 192.2
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 39% 74% 121.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 44% 192.2

Sequence Analysis Tools

View WP_013644846.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNNNVLEFENVSKTYKMGDETIKALDGLNVALKRGSFKAVMGPSGSGKSTFLHVAGILDM
PTSGLIQINGKETKKLSNKEQAKLRRNEIGFIFQRFNLMSQLTVLENVMLPMIEENTNKA
IELLNKMGLSSKADKYPSHLSGGEQQRVAIARALINDPSIILADEPTGELDTKNANAIMQ
ILKDLNQKDGVSIVVVTHNQASADYADEILHMSDGNFVENAN

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory