Protein WP_013645374.1 in Methanobacterium lacus AL-21
Annotation: NCBI__GCF_000191585.1:WP_013645374.1
Length: 223 amino acids
Source: GCF_000191585.1 in NCBI
Candidate for 35 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-glutamate catabolism | gltL | med | GluA aka CGL1950, component of Glutamate porter (characterized) | 42% | 88% | 160.6 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-asparagine catabolism | glnQ | med | Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) | 42% | 89% | 156.4 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-asparagine catabolism | peb1C | med | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 42% | 88% | 153.3 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-aspartate catabolism | peb1C | med | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 42% | 88% | 153.3 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-asparagine catabolism | aatP | med | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 41% | 89% | 152.5 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-aspartate catabolism | aatP | med | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 41% | 89% | 152.5 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-lysine catabolism | hisP | med | Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) | 41% | 83% | 150.6 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-asparagine catabolism | bgtA | med | ATPase (characterized, see rationale) | 41% | 83% | 146.7 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-aspartate catabolism | bgtA | med | ATPase (characterized, see rationale) | 41% | 83% | 146.7 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-asparagine catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 40% | 83% | 153.7 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-aspartate catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 40% | 83% | 153.7 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| putrescine catabolism | potA | lo | Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) | 40% | 55% | 153.3 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-asparagine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 40% | 83% | 148.7 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-aspartate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 40% | 83% | 148.7 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-glutamate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 40% | 83% | 148.7 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-histidine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 40% | 83% | 148.7 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-leucine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 40% | 83% | 148.7 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-proline catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 40% | 83% | 148.7 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| D-mannitol catabolism | mtlK | lo | SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) | 36% | 63% | 142.5 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| D-alanine catabolism | Pf6N2E2_5405 | lo | ABC transporter for D-Alanine, ATPase component (characterized) | 38% | 84% | 141 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) | 37% | 57% | 138.3 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| lactose catabolism | lacK | lo | ABC transporter for Lactose, ATPase component (characterized) | 37% | 59% | 135.2 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-citrulline catabolism | PS417_17605 | lo | ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) | 37% | 82% | 133.3 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-histidine catabolism | Ac3H11_2560 | lo | ABC transporter for L-Histidine, ATPase component (characterized) | 41% | 67% | 132.1 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| D-glucosamine (chitosamine) catabolism | AO353_21725 | lo | ABC transporter for D-Glucosamine, putative ATPase component (characterized) | 37% | 87% | 131.7 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| D-maltose catabolism | malK | lo | Maltose-transporting ATPase (EC 3.6.3.19) (characterized) | 35% | 56% | 130.2 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-tryptophan catabolism | ecfA1 | lo | Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) | 37% | 78% | 129 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-tryptophan catabolism | ecfA2 | lo | Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) | 35% | 75% | 122.9 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| L-arabinose catabolism | xylGsa | lo | Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) | 35% | 87% | 120.6 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| D-mannose catabolism | TM1749 | lo | TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) | 34% | 71% | 120.2 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| D-fructose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 30% | 85% | 102.4 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| D-mannose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 30% | 85% | 102.4 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| D-ribose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 30% | 85% | 102.4 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| sucrose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 30% | 85% | 102.4 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
| D-cellobiose catabolism | TM0028 | lo | TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) | 32% | 71% | 100.5 | As-48G, component of The enterocin AS-48 exporter, As-48FGH | 45% | 191.8 |
Sequence Analysis Tools
View WP_013645374.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MNDNTIIKIKNLKKEYEDGSIIALNNVDLEIERGESVSIIGPSGSGKSTLLNMIGGLDKA
NEGQISVAGVNLMDNSDLSNFRSNEIGFVFQLHNLIPNLTVLENVQIPLLGTDIDDKKME
ERALKLLKSVNLENKVDQKPTKLSGGERQRVAIARALVNHPSIILADEPTGALDSETQEV
ILKLLLDIHKKENVTLIMVTHEPYVAKQADRSIYVLDGKIKPT
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory