Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_013645098.1 METBO_RS07515 ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_000191585.1:WP_013645098.1 Length = 230 Score = 149 bits (377), Expect = 4e-41 Identities = 89/225 (39%), Positives = 137/225 (60%), Gaps = 5/225 (2%) Query: 1 MIELKNVNKYY--GTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEV 58 +IE+K++ K Y G L +NL+VK+GE + I+GPSGSGKS+ + + GL+ G + Sbjct: 6 IIEIKDLKKGYDNGKIKALNGMNLNVKKGEFISIMGPSGSGKSSLLNMIGGLDVADEGTI 65 Query: 59 VVNNL-VLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAF 117 V + ++ KN + K VFQ NL P++TV++N+ + PM S K+ + A Sbjct: 66 NVAGIDMMKTKNLNKFRSKEIGFVFQMHNLIPNLTVVENVEI-PMYETNTSSKDMRKKAL 124 Query: 118 KYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDV 177 LK VGL DK + P LSGGQ+QRVAIAR+L IL DEPT +LD +T + +L++ Sbjct: 125 ALLKSVGLEDKVDQKPTKLSGGQRQRVAIARALVNNPSIILADEPTGSLDSKTGEVILNL 184 Query: 178 MKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSE 222 +K++ + N T+V+VTHE + +A+RI+ + DG + + SE Sbjct: 185 LKDLHAKENVTLVMVTHE-PYVGNMAERIVTVLDGKCLSDKKTSE 228 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 230 Length adjustment: 23 Effective length of query: 219 Effective length of database: 207 Effective search space: 45333 Effective search space used: 45333 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory