Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized)
to candidate WP_013645542.1 METBO_RS09755 ATP-binding cassette domain-containing protein
Query= reanno::pseudo3_N2E3:AO353_16275 (244 letters) >NCBI__GCF_000191585.1:WP_013645542.1 Length = 279 Score = 143 bits (361), Expect = 3e-39 Identities = 84/233 (36%), Positives = 136/233 (58%), Gaps = 10/233 (4%) Query: 15 QVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDVVVDGTSIADPKTDLPK 74 + L + ++G+++ + GP+G+GKSTL N + G V VDG +++ K +L K Sbjct: 18 KALEKVNFNAEEGKIVALLGPNGAGKSTLFLHFNGILRPTHGSVHVDGETVSYDKKELLK 77 Query: 75 LRSRVGMVFQH--FELFPHLTITENLTIAQIKVLGRSKEEATKKGLQLLERVGLSAHAHK 132 +R +VG+VFQ+ +LF T+ E++ + +G S EE ++ L RVG+ + K Sbjct: 78 IRQKVGIVFQNPDDQLFAP-TVLEDVAFGPMN-MGLSNEEVDERVKDALLRVGMEGYEKK 135 Query: 133 HPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDVMVQLANEGMTMMCV 192 P LSGGQ++RVAIA LAM P +M+ DEPTS LDP +++L ++ QL +EGMT++ Sbjct: 136 APHHLSGGQKKRVAIAGILAMKPKIMVLDEPTSGLDPRGASQILKLLYQLNSEGMTIVIS 195 Query: 193 THEMGFARKVADRVIFMDQGKIIEDCKKEEFFGDI------NARSDRAQHFLD 239 TH++ A +V + QGKII++ ++ F D+ N R R H ++ Sbjct: 196 THDVDLVPIYASKVYIISQGKIIKEGNPQDVFEDVETIRGANLRLPRIAHLME 248 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 279 Length adjustment: 25 Effective length of query: 219 Effective length of database: 254 Effective search space: 55626 Effective search space used: 55626 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory