Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate WP_013645098.1 METBO_RS07515 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_00465 (263 letters) >NCBI__GCF_000191585.1:WP_013645098.1 Length = 230 Score = 130 bits (326), Expect = 3e-35 Identities = 82/233 (35%), Positives = 143/233 (61%), Gaps = 21/233 (9%) Query: 9 NTQPLLDIRGLRKQY--GPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQ 66 N + +++I+ L+K Y G ++ L G++L++++G ++++G SGSGK++LL + Sbjct: 2 NNENIIEIKDLKKGYDNGKIKALNGMNLNVKKGEFISIMGPSGSGKSSLLNMI------- 54 Query: 67 GGQIVLDGESIGYDDIDGKRVRHPEKLIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLK 126 GG V D +I ID + ++ K ++ G FQ NL P+LT ++NV + + + Sbjct: 55 GGLDVADEGTINVAGIDMMKTKNLNKFRSKE---IGFVFQMHNLIPNLTVVENVEIPMYE 111 Query: 127 VKKLPKD---EAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFD 183 KD +A+AL L+ VGL ++ D P +LSGGQ+QRVAIARA+ NPS++L D Sbjct: 112 TNTSSKDMRKKALAL----LKSVGLEDKVDQKPTKLSGGQRQRVAIARALVNNPSIILAD 167 Query: 184 EVTSALDPELVGEVLNVIKGL-AEDGMTMLLVTHEMRFAFEVSDKIVFMNQGR 235 E T +LD + +LN++K L A++ +T+++VTHE + ++++IV + G+ Sbjct: 168 EPTGSLDSKTGEVILNLLKDLHAKENVTLVMVTHE-PYVGNMAERIVTVLDGK 219 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 230 Length adjustment: 24 Effective length of query: 239 Effective length of database: 206 Effective search space: 49234 Effective search space used: 49234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory