Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate WP_013645165.1 METBO_RS07885 ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >NCBI__GCF_000191585.1:WP_013645165.1 Length = 230 Score = 125 bits (314), Expect = 8e-34 Identities = 82/241 (34%), Positives = 130/241 (53%), Gaps = 20/241 (8%) Query: 13 QALLEIRDLHKQYG----PLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQ 68 Q L+ ++L K Y + L+G+++T+ G V+++G SGSGK+TL+ + L+ Sbjct: 2 QNLVNGKELWKTYDLGGVKVNALRGLNITVDEGEFVSIMGPSGSGKSTLMNLIGCLDTPT 61 Query: 69 GGQILLDGESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLK 128 G++ +DG I + + +EK+ G FQ FNL P L+ NV + Sbjct: 62 EGELTIDGREISSMKESELTKVRAEKI--------GFIFQTFNLLPALSVRDNVEFPMRN 113 Query: 129 V---KKLHKDEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFD 185 + KKL+K AE+ LE VGL R DH P +LSGG++QRVAIARA+ P +L D Sbjct: 114 LSGDKKLNKSARRARAEECLECVGLGHRLDHLPAKLSGGERQRVAIARALVNKPKFILAD 173 Query: 186 EVTSALDPELVGEVLSVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPK 245 E T LD E ++ ++ + + G T+++VTH++ + +I+ + G IE P K Sbjct: 174 EPTGNLDTESTENIMKLLHDINDMGTTVIMVTHDVETT--ENTRILRIRDGVIE---PNK 228 Query: 246 E 246 E Sbjct: 229 E 229 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 125 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 230 Length adjustment: 24 Effective length of query: 241 Effective length of database: 206 Effective search space: 49646 Effective search space used: 49646 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory