Align Histidine transport ATP-binding protein HisP (characterized)
to candidate WP_013644846.1 METBO_RS06275 ABC transporter ATP-binding protein
Query= SwissProt::P02915 (258 letters) >NCBI__GCF_000191585.1:WP_013644846.1 Length = 222 Score = 140 bits (353), Expect = 2e-38 Identities = 86/240 (35%), Positives = 137/240 (57%), Gaps = 23/240 (9%) Query: 2 MSENKLHVIDLHKRYG-GHEVLK---GVSLQARAGDVISIIGSSGSGKSTFLRCINFLEK 57 M+ N L ++ K Y G E +K G+++ + G +++G SGSGKSTFL L+ Sbjct: 1 MNNNVLEFENVSKTYKMGDETIKALDGLNVALKRGSFKAVMGPSGSGKSTFLHVAGILDM 60 Query: 58 PSEGAIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEA 117 P+ G I +NG+ K+++K Q +L R + +FQ FNL S +TVLENVM Sbjct: 61 PTSGLIQINGKETK---------KLSNKEQAKLRRNEIGFIFQRFNLMSQLTVLENVMLP 111 Query: 118 PIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLF 177 I+ + +A++ L K+G+ +A KYP HLSGG+QQRV+IARAL +P ++L Sbjct: 112 MIE-------ENTNKAIELLNKMGLSSKAD-KYPSHLSGGEQQRVAIARALINDPSIILA 163 Query: 178 DEPTSALDPELVGEVLRIMQQL-AEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGD 236 DEPT LD + +++I++ L ++G ++VVVTH A + + ++ + G E + Sbjct: 164 DEPTGELDTKNANAIMQILKDLNQKDGVSIVVVTHNQASADY-ADEILHMSDGNFVENAN 222 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 222 Length adjustment: 23 Effective length of query: 235 Effective length of database: 199 Effective search space: 46765 Effective search space used: 46765 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory