Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate WP_013645374.1 METBO_RS08905 ABC transporter ATP-binding protein
Query= uniprot:Q88GX0 (260 letters) >NCBI__GCF_000191585.1:WP_013645374.1 Length = 223 Score = 146 bits (369), Expect = 3e-40 Identities = 85/214 (39%), Positives = 129/214 (60%), Gaps = 4/214 (1%) Query: 20 LIRIEGLNKHY--GAFHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQGSI 77 +I+I+ L K Y G+ L ++DL++ GE + + GPSGSGKSTL+ I L+ A +G I Sbjct: 6 IIKIKNLKKEYEDGSIIALNNVDLEIERGESVSIIGPSGSGKSTLLNMIGGLDKANEGQI 65 Query: 78 QVDGIDLAATTREAAQVRSDIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSRKDAEERAR 137 V G++L + + ++IG VFQ NL P+++VL+N + P + K EERA Sbjct: 66 SVAGVNLMDNSDLSNFRSNEIGFVFQLHNLIPNLTVLENVQI-PLLGTDIDDKKMEERAL 124 Query: 138 MYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMVAEVLDV 197 L V +E++ + P++LSGG++QRVAIARAL P I+L DEPT ALD E +L + Sbjct: 125 KLLKSVNLENKVDQKPTKLSGGERQRVAIARALVNHPSIILADEPTGALDSETQEVILKL 184 Query: 198 LVQL-AGTGMTMLCVTHEMGFARQVAERVLFLEG 230 L+ + +T++ VTHE A+Q + L+G Sbjct: 185 LLDIHKKENVTLIMVTHEPYVAKQADRSIYVLDG 218 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 223 Length adjustment: 23 Effective length of query: 237 Effective length of database: 200 Effective search space: 47400 Effective search space used: 47400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory