Align ABC transporter for L-Lysine, ATPase component (characterized)
to candidate WP_013645398.1 METBO_RS09015 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09895 (257 letters) >NCBI__GCF_000191585.1:WP_013645398.1 Length = 228 Score = 141 bits (356), Expect = 1e-38 Identities = 89/209 (42%), Positives = 127/209 (60%), Gaps = 17/209 (8%) Query: 8 LEIRNLHKRY--GQLEVLKGVSLTARDGDVISILGSSGSGKSTFLRCINLLENPNQGQIL 65 +EI+NL K Y G ++ L G+ LT + G+ ISI+G SGSGKST L I L+ ++G I Sbjct: 8 IEIKNLKKSYDNGNIKALNGIDLTVKKGEFISIMGPSGSGKSTLLNMIGALDTADEGMIK 67 Query: 66 VAGEELKLKAAKNGELVAADGKQINRLRS-EIGFVFQNFNLWPHMSVLDNIIEAPRRVLG 124 VAG +L +KA K++N RS EIGFVFQ NL P++SV++N+ E P Sbjct: 68 VAGIDL-MKA-----------KKLNLFRSQEIGFVFQMHNLIPNLSVIENV-EIPMYETK 114 Query: 125 QSKAEAVEVAEALLAKVGIADKRHAYPAELSGGQQQRAAIARTLAMQPKVILFDEPTSAL 184 + +E E A LL V + K P +LSGG++QR AIAR L P +IL DEPT +L Sbjct: 115 ANSSEMRERALELLKSVNLEKKIDQKPTKLSGGERQRVAIARALVNHPSIILADEPTGSL 174 Query: 185 DPEMVQEVLSVIRAL-AEEGRTMLLVTHE 212 D + + +L +++ L +E T+++VTHE Sbjct: 175 DSKTGEVILDLLKELHTKENVTLVMVTHE 203 Lambda K H 0.317 0.132 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 228 Length adjustment: 23 Effective length of query: 234 Effective length of database: 205 Effective search space: 47970 Effective search space used: 47970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory