Align NADH-dependent phenylglyoxylate dehydrogenase subunit delta; Phenylglyoxylate:NAD oxidoreductase; Phenylglyoxylate:acceptor oxidoreductase; EC 1.2.1.58 (characterized)
to candidate WP_013644092.1 METBO_RS02490 pyruvate synthase subunit PorD
Query= SwissProt::Q8L3B2 (93 letters) >NCBI__GCF_000191585.1:WP_013644092.1 Length = 80 Score = 68.2 bits (165), Expect = 2e-17 Identities = 23/55 (41%), Positives = 38/55 (69%), Gaps = 3/55 (5%) Query: 34 GDWRSMRPVVDRDKCVKCAVCWLYCPVQCVEEHAAWFDFNLKTCKGCGICANECP 88 G WR+ +P++D++ C+ C C ++CP C++++ +D + CKGCGICA ECP Sbjct: 20 GSWRTFKPILDKETCIDCENCVMFCPEGCIDKN---YDIDYDYCKGCGICAEECP 71 Lambda K H 0.327 0.139 0.509 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 63 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 93 Length of database: 80 Length adjustment: 9 Effective length of query: 84 Effective length of database: 71 Effective search space: 5964 Effective search space used: 5964 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (20.8 bits) S2: 38 (19.2 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory