Align Iron-sulfur cluster-binding oxidoreductase, CCG domain pair-containing, putative benzoyl-CoA reductase electron transfer protein (characterized, see rationale)
to candidate WP_013644575.1 METBO_RS04930 (Fe-S)-binding protein
Query= uniprot:Q39TW0 (387 letters) >NCBI__GCF_000191585.1:WP_013644575.1 Length = 239 Score = 154 bits (390), Expect = 2e-42 Identities = 91/240 (37%), Positives = 137/240 (57%), Gaps = 11/240 (4%) Query: 150 LLYFTGCYLSYDPRMRKVAAATAAILNKAGVDFGILGSKESCCGESIRKTGNEELFKRLA 209 +LYF GC + ++ VA AT IL KAGVD+ +LG+ ESCCG + +TG ++ + + Sbjct: 1 MLYFKGCVVR--EKLPGVAQATEKILKKAGVDYTLLGN-ESCCGSFLMRTGFKDEAEEVM 57 Query: 210 KENIKQFIDNGVTKILVSSPHCYHTFVNEYPE-FKVNFEVVFISQYIGQLINEGRLQITG 268 K N++ + ILVS CY+T N+Y F V +V+ S+ + +L+ + ++ + Sbjct: 58 KNNLQDILAANEKTILVSCSGCYNTLKNDYKALFDVELDVIHTSELVKELLVKNKIHVNS 117 Query: 269 EFAKKVTYHDPCYLGRHNGIYDEPRQVLQQVPGLELLEMADNRESSLCCGGGGGRIWMET 328 K VTYHDPC+LGRH+GIY+EPR ++ +L+EM NRE S CCG G G Sbjct: 118 T-EKTVTYHDPCHLGRHSGIYEEPRDAIK--ASADLVEMKRNRERSRCCGAGSGVKSAFP 174 Query: 329 PKEERFADLRIRQAVDVGATVLATSCPYCITNF---TDSSLDLADHEKVE-VKDLAEIIL 384 RI+ A +VGA +L T+C +CI N + + + ++ VE V DL E+IL Sbjct: 175 ELALEVGCRRIQDAEEVGADILVTTCSFCILNLENALEKTKNQGENGSVERVMDLTELIL 234 Lambda K H 0.320 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 239 Length adjustment: 27 Effective length of query: 360 Effective length of database: 212 Effective search space: 76320 Effective search space used: 76320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory