Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate WP_013644018.1 METBO_RS02115 lactaldehyde dehydrogenase
Query= metacyc::MONOMER-11560 (497 letters) >NCBI__GCF_000191585.1:WP_013644018.1 Length = 468 Score = 268 bits (684), Expect = 4e-76 Identities = 171/477 (35%), Positives = 256/477 (53%), Gaps = 21/477 (4%) Query: 21 RAFINGEYTDAVSGETFECLSPVDGRFLAKVASCDLADANRAVENARATFNSGVWSQLAP 80 + ING D S E + ++PV+ + + V S + D A+E A V++ + Sbjct: 2 KMIINGSLVD--SDEKIDVVNPVNNQVIDTVPSGTIEDVKTALETAYEA--QKVFANYSS 57 Query: 81 AKRKAKLIRFADLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEAIDKVYD 140 K + + L++N +ELA L T + GKPI DS+ +I + + + AE ++Y Sbjct: 58 RKVSRIMYDIYEDLKQNSKELADLLTRETGKPIKDSND-EIKRSIETVLLAAEESKRIYG 116 Query: 141 EVAPTP-----HDQLGLVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSEK 195 E P LG + P+G+V AI P+N+P+ +A K+ PA+A N+V+LKPS + Sbjct: 117 ETVPLDAGIGGRTALGFTVKVPLGIVTAITPFNYPVNLAVHKIAPAIAAKNAVILKPSTQ 176 Query: 196 SPLTAIRIAQLAIEAGIPAGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMVY 255 +PL A+++ Q+ + +PAGV++ + G +G L + V+ + FTGS + + Sbjct: 177 APLAALKMVQI-FNSHLPAGVVSAVTGKSSVIGDELVTNPRVNKISFTGSVETGVSISEK 235 Query: 256 AGESNMKRIWLEAGGKSPNIVFADAPDLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIK 315 AG MKRI +E GG P IV DA D+ A EAA G+VC A R+++E SI Sbjct: 236 AG---MKRINMELGGNDPLIVLEDA-DIDRAVEAAIKGSFLFSGQVCIAVKRIILEESIA 291 Query: 316 DKFLPMVVEALKGWKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAGGKRTL 375 D+F +V+ K K G+PL+P+T +G ++D Q V + + GAKLL GG+R Sbjct: 292 DEFAAKMVQRTKKLKVGDPLNPETDMGPMIDEQAAINVENLVNNAKSSGAKLLVGGERE- 350 Query: 376 EETGGTYVEPTIFDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIANDTPYGLAAGIWT 435 G + PTI D V +M + E FGPV ++ +EA+ IANDT YGL AGI+T Sbjct: 351 ----GAFYLPTILDHVETSMDMVCNETFGPVAPLLRVKNLDEAINIANDTQYGLQAGIFT 406 Query: 436 SDISKAHKTARAVRAGSVWVN-QYDGGDMTAPFGGFKQSGNGRDKSLHALEKYTELK 491 I A K AR + AGSV +N Q PFGGFK SG G++ +A+E T K Sbjct: 407 KSIENALKAAREIEAGSVIINRQSTFRTDNMPFGGFKMSGTGKEGIKYAVEDMTRSK 463 Lambda K H 0.316 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 523 Number of extensions: 31 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 468 Length adjustment: 34 Effective length of query: 463 Effective length of database: 434 Effective search space: 200942 Effective search space used: 200942 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory