Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_013644688.1 METBO_RS05480 tungstate ABC transporter ATP-binding protein WtpC
Query= reanno::acidovorax_3H11:Ac3H11_2941 (350 letters) >NCBI__GCF_000191585.1:WP_013644688.1 Length = 348 Score = 203 bits (517), Expect = 5e-57 Identities = 122/339 (35%), Positives = 191/339 (56%), Gaps = 25/339 (7%) Query: 19 IKGIDLTIQQGEFIVFVGPSGCGKSTLLRLIAGLEAIDGGSLMLDGRDITDQPSSKRDLA 78 I + L I + E+ VF+GPSG GK+ LL LIAG+ D G + ++ +D+T+ P KR + Sbjct: 16 INDVTLEINEDEYFVFLGPSGSGKTMLLELIAGMWTPDSGKIYINNQDVTNFPPEKRGVG 75 Query: 79 MVFQSYALYPHMSVYENMSFALKLAKVDKQVIDEKVQNAARILNLTQYLQRTPKELSGGQ 138 V+Q+Y L+PH +V+EN++F L + KVDK+ I+E+V + ++ R P+ LSGG+ Sbjct: 76 FVYQNYMLFPHKTVFENIAFGLNIRKVDKKKIEEQVGEMMDLFGISHLAHRLPRTLSGGE 135 Query: 139 RQRVAIGRAIVRAPKVFLFDEPLSNLDAALRGQTRVEIAKLHRDLGATTIYVTHDQVEAM 198 +QR A+ RA++ PKV L DEPLS LD R + E K+H + T I VTH+ EA+ Sbjct: 136 QQRTALARALIIRPKVLLMDEPLSALDRITREELIREFKKIHEEFNITIIQVTHNFDEAL 195 Query: 199 TLADRVVVLRDGIIEQVGTPLELYDKPANQFVAQFIGTPQM----------NVVPVDKLP 248 LA+R+ +++ G + QVG+ E++ +P ++FVA F+GT + N+ VD Sbjct: 196 QLAERIAIIKQGTVSQVGSTDEVFRRPKDEFVADFVGTENIIRGVATDGEENLTSVD--T 253 Query: 249 QPVQQQAPAAPAGAAVGAIGLRPENITVRTTGATPVG-----GQVDLIEALGAETLIYVT 303 + ++ G +RPE ITV T+ T G++ I LG T+I +T Sbjct: 254 GNIVVESTEHKTGKV--HFTIRPEAITVSTSRITTSARNEFKGKLTEIYDLG--TIIKLT 309 Query: 304 TPGGAQFV---SRQN-DRTDLRVGDAVSLDIDASQAHWF 338 G QFV +RQ+ D +L +G V + A+ + F Sbjct: 310 VDVGEQFVLVLTRQSFDDLELNIGKEVFISFKATAVNLF 348 Lambda K H 0.320 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 348 Length adjustment: 29 Effective length of query: 321 Effective length of database: 319 Effective search space: 102399 Effective search space used: 102399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory