Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_013706916.1 DESAC_RS16640 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_000195295.1:WP_013706916.1 Length = 399 Score = 372 bits (955), Expect = e-107 Identities = 191/396 (48%), Positives = 272/396 (68%), Gaps = 7/396 (1%) Query: 6 IRDVDLKGKRVIMRVDFNVPV-KDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPK 64 ++DVD++ K V +RVDFNVP+ ++ + DDTRIRA LPTI + L++ A+VIL SHLGRPK Sbjct: 4 LQDVDIREKTVFIRVDFNVPLDRNRNITDDTRIRAVLPTINHCLDEHARVILASHLGRPK 63 Query: 65 GEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGET 124 G P P SL PV++RLS L+ K V+FVP +G EV+K ++++ G+VLLLEN RF+P E Sbjct: 64 G-PDPNKSLEPVSRRLSRLIHKTVEFVPDCIGPEVQKIKQKMQPGDVLLLENLRFYPEEE 122 Query: 125 KNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIP-SVAGFLMEKEIKFLSKVTY 183 KND + A+ D+++NDAF HRAHAS + F P AGFL+ EI + K Sbjct: 123 KNDQDFARQLMEGVDVYINDAFAVGHRAHASVHAVTLFAPICAAGFLLRDEILYFHKSME 182 Query: 184 NPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKI 243 +P +P V ++GGAK+S K+ + NL++ D+++IGGAM TF+KA+G +VG S V++ + Sbjct: 183 DPARPLVAIIGGAKISSKLTALINLLKHVDKLIIGGAMANTFIKAMGYQVGKSLVDDSLL 242 Query: 244 DLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIEL 303 D AKEL+ A +KGV+ LPVD ++A ++ E +V I + +P W+ DIGP +I L Sbjct: 243 DEAKELMSTALQKGVKFYLPVDVIVADSLDNRAENRVTTIQE-VPADWIIADIGPASITL 301 Query: 304 FKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAVNKF 363 F + L DA+TVVWNGPMG FEI+ F+ GT + +A A+T+VGGGD+ A++K Sbjct: 302 FNEALQDARTVVWNGPMGAFEIEAFSRGTLAMVHNVA---NSFALTIVGGGDTDVAIHKA 358 Query: 364 GLEDKFSHVSTGGGASLEFLEGKELPGIASIADKKK 399 G +KFS++STGGGA LE LEGK+LPGI ++ + K Sbjct: 359 GEVNKFSYISTGGGAFLELLEGKKLPGILALEEWHK 394 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 604 Number of extensions: 34 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 399 Length adjustment: 34 Effective length of query: 620 Effective length of database: 365 Effective search space: 226300 Effective search space used: 226300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory