Align ABC transporter related (characterized, see rationale)
to candidate WP_013705639.1 DESAC_RS03195 ABC transporter ATP-binding protein
Query= uniprot:B2TBJ9 (263 letters) >NCBI__GCF_000195295.1:WP_013705639.1 Length = 233 Score = 130 bits (327), Expect = 2e-35 Identities = 85/230 (36%), Positives = 131/230 (56%), Gaps = 16/230 (6%) Query: 6 PVALSVKNIHKSFGDHH----VLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPD 61 PV + +K++ KS+ VL+ + LD +G+ ++++G SGSGK+T L + ++ PD Sbjct: 8 PVIVEIKDLSKSYRRGAQIIPVLQHVCLDIQEGEFLALMGPSGSGKTTLLNLIAGIDQPD 67 Query: 62 DGSVSLAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPM 121 G + +AG ++ R + +L R V G +FQ +NL +T LEN +E P+ Sbjct: 68 AGILRVAGVDIS--RLSESELAVWRHRNV-------GFIFQFYNLVPVLTALEN-VELPL 117 Query: 122 RVQKRSRAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEP 181 + +A+ + AE L VG+ ++R HYP LSGGQQQRVAIARA+ P ++ DEP Sbjct: 118 MLSDLPKAKRRQHAELALKLVGIYDRRDHYPRQLSGGQQQRVAIARAIVTDPTIIAADEP 177 Query: 182 TSALDPELVGEVLRVMRSLAEEGR-TMLVVTHEMGFARHVSNRVMFLHQG 230 T LD EVL +M L +E R T+++VTH+ A S R+ L +G Sbjct: 178 TGDLDKVSAEEVLNLMTRLNQELRKTIIMVTHDPR-AAEKSTRLQHLDKG 226 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 233 Length adjustment: 24 Effective length of query: 239 Effective length of database: 209 Effective search space: 49951 Effective search space used: 49951 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory