Align GtsD (GLcK), component of Glucose porter, GtsABCD (characterized)
to candidate WP_013705639.1 DESAC_RS03195 ABC transporter ATP-binding protein
Query= TCDB::Q88P35 (384 letters) >NCBI__GCF_000195295.1:WP_013705639.1 Length = 233 Score = 132 bits (333), Expect = 7e-36 Identities = 75/200 (37%), Positives = 116/200 (58%), Gaps = 8/200 (4%) Query: 4 LELRNVNKTY--GSGLPDTLKDIQLSIKDGEFLILVGPSGCGKSTLMNCIAGLEQITGGA 61 +E+++++K+Y G+ + L+ + L I++GEFL L+GPSG GK+TL+N IAG++Q G Sbjct: 11 VEIKDLSKSYRRGAQIIPVLQHVCLDIQEGEFLALMGPSGSGKTTLLNLIAGIDQPDAGI 70 Query: 62 ILIDEQDVSGMSPKD------RDIAMVFQSYALYPTMSVRENIEFGLKIRKLPQAAIDEE 115 + + D+S +S + R++ +FQ Y L P ++ EN+E L + LP+A + Sbjct: 71 LRVAGVDISRLSESELAVWRHRNVGFIFQFYNLVPVLTALENVELPLMLSDLPKAKRRQH 130 Query: 116 VARVAKLLQIEHLLARKPAQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMR 175 KL+ I P QLSGGQQQRVA+ RA+ P I DEP +LD E+ Sbjct: 131 AELALKLVGIYDRRDHYPRQLSGGQQQRVAIARAIVTDPTIIAADEPTGDLDKVSAEEVL 190 Query: 176 TEMKLMHQRLKTTTVYVTHD 195 M ++Q L+ T + VTHD Sbjct: 191 NLMTRLNQELRKTIIMVTHD 210 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 233 Length adjustment: 27 Effective length of query: 357 Effective length of database: 206 Effective search space: 73542 Effective search space used: 73542 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory