Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_013706034.1 DESAC_RS05240 ATP-binding cassette domain-containing protein
Query= uniprot:A0A165KQ08 (355 letters) >NCBI__GCF_000195295.1:WP_013706034.1 Length = 251 Score = 147 bits (370), Expect = 4e-40 Identities = 78/213 (36%), Positives = 122/213 (57%), Gaps = 8/213 (3%) Query: 35 EFLILVGPSGCGKSTLLNIIAGLDEPTEGEIRIGGKNV------VGMPPRDRDIAMVFQS 88 E +L G SG GKS L +IAG +P G I G+ + + +PP+ R + VFQ Sbjct: 25 ELAVLFGYSGAGKSLTLQLIAGFLQPDTGRITANGQVLFDSRMRINVPPQRRSLGYVFQD 84 Query: 89 YALYPTLSVADNIGFALEMRKMPKPERQKRIDEVAAMLQISHLLDRRPSQLSGGQRQRVA 148 AL+P ++V NI + + + ER++R++E+ + + L + P+++SGGQ+QRVA Sbjct: 85 LALFPHMTVRQNIAYGAT--GLSRTEREQRVEEMLHIFHLEGLARKPPAEISGGQKQRVA 142 Query: 149 MGRALARQPQLFLFDEPLSNLDAKLRVEMRAEIKRLHQASGITSVYVTHDQVEAMTLGSR 208 + RAL R+PQ L DEP S LD LR EMR +K++H+ + + VTHD +EA +L Sbjct: 143 LARALIRRPQALLLDEPFSALDNPLRREMRRFLKQIHREFALPVILVTHDLLEATSLADT 202 Query: 209 IAVMKGGVVQQLGTPDEIYNRPANTYVATFIGS 241 + + G + Q G+P I ++P VA + S Sbjct: 203 LLIYTAGKIAQRGSPQAIISQPRTPEVAALVAS 235 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 251 Length adjustment: 27 Effective length of query: 328 Effective length of database: 224 Effective search space: 73472 Effective search space used: 73472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory