Align ABC transporter for Lactose, ATPase component (characterized)
to candidate WP_013705639.1 DESAC_RS03195 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b20002 (358 letters) >NCBI__GCF_000195295.1:WP_013705639.1 Length = 233 Score = 127 bits (320), Expect = 2e-34 Identities = 79/203 (38%), Positives = 119/203 (58%), Gaps = 16/203 (7%) Query: 4 LQLSDVRKSYGG----LEVIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGD 59 +++ D+ KSY + V++ V LDI+ GEF+ +GPSG GK+TLL +IAG+++ +G Sbjct: 11 VEIKDLSKSYRRGAQIIPVLQHVCLDIQEGEFLALMGPSGSGKTTLLNLIAGIDQPDAGI 70 Query: 60 LTIDDVRMNDVDPSK------RGIAMVFQSYALYPHMTVRENMGFALRFAGVPRAEIEKR 113 L + V ++ + S+ R + +FQ Y L P +T EN+ L + +P+A KR Sbjct: 71 LRVAGVDISRLSESELAVWRHRNVGFIFQFYNLVPVLTALENVELPLMLSDLPKA---KR 127 Query: 114 VNEAAHILELGALLDRK---PKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRV 170 A L+L + DR+ P+QLSGGQ+QRVAI RAIV P I DEP +LD Sbjct: 128 RQHAELALKLVGIYDRRDHYPRQLSGGQQQRVAIARAIVTDPTIIAADEPTGDLDKVSAE 187 Query: 171 HMRIEIARLHKQLATTIVYVTHD 193 + + RL+++L TI+ VTHD Sbjct: 188 EVLNLMTRLNQELRKTIIMVTHD 210 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 233 Length adjustment: 26 Effective length of query: 332 Effective length of database: 207 Effective search space: 68724 Effective search space used: 68724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory