Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_013705319.1 DESAC_RS01540 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQI0 (292 letters) >NCBI__GCF_000195295.1:WP_013705319.1 Length = 302 Score = 262 bits (670), Expect = 6e-75 Identities = 143/302 (47%), Positives = 196/302 (64%), Gaps = 10/302 (3%) Query: 1 MNLMLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAFI---------GY 51 M L LQ L+N L LGSVYAL+ALGY+MVYGI+ +INFAHGDI+M+GA++ G Sbjct: 1 MALALQYLLNALQLGSVYALIALGYSMVYGILTMINFAHGDIFMVGAYLAMWAACFLLGL 60 Query: 52 FLINSFQMNFFVALIVAMLATAILGVVIEFLAYRPLRHSTRIAVLITAIGVSFLLEYGMV 111 L F AL+ +M TA+LGV IE LAYRPLR + R++ +ITA+GV LE + Sbjct: 61 NLTFPAMFVFLGALLFSMTLTAVLGVAIERLAYRPLRQAPRVSAVITALGVGLFLENFTL 120 Query: 112 YLVGANTRAFPQAIQTVRYDLGPISLTNVQLMILGISLILMILLQVIVQKTKMGKAMRAV 171 +G R P I + IS TN+Q++I+ +++ LM+LL +V+ T G AMRA+ Sbjct: 121 ATIGPEPRQIPAIIPVQQLSWAGISFTNIQILIIIVAIGLMLLLDWVVRHTMTGMAMRAI 180 Query: 172 SVDSDAAQLMGINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTPGLKSFVAAV 231 S D A LMG+ VNR IS TFA+GSA+AGA G+L L Y L+P MG+ G +F++AV Sbjct: 181 SYDCQVAPLMGVPVNRVISLTFAIGSAIAGAGGLLYGLAYPVLDPYMGIRIGWWAFISAV 240 Query: 232 LGGIGIIPGAALGGFVIGLLETFA-TAFGMSDFRDAIVYGILLLILIVRPAGILGKNVKE 290 +GGIG I GA LGGF++G +E F S +RD + + +LL++L+ +P GILG+ E Sbjct: 241 VGGIGNIRGAMLGGFLLGAVEIFTPVLLASSTYRDCVAFSMLLILLVFKPTGILGRPTFE 300 Query: 291 KV 292 KV Sbjct: 301 KV 302 Lambda K H 0.330 0.146 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 302 Length adjustment: 26 Effective length of query: 266 Effective length of database: 276 Effective search space: 73416 Effective search space used: 73416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory