Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_013706219.1 DESAC_RS06200 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQI0 (292 letters) >NCBI__GCF_000195295.1:WP_013706219.1 Length = 298 Score = 264 bits (675), Expect = 2e-75 Identities = 133/288 (46%), Positives = 206/288 (71%), Gaps = 3/288 (1%) Query: 2 NLMLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAFIGYFLINSFQMNF 61 +++LQQL+NG+ LGS+YAL+A+GYTMVYG+++LINFAHGD M+ A++G F ++ F + + Sbjct: 4 SVLLQQLINGVSLGSLYALIAIGYTMVYGVLRLINFAHGDFLMVAAYLGLFGLSLFSLPW 63 Query: 62 FVALIVAMLATAILGVVIEFLAYRPLRHSTRIAVLITAIGVSFLLEYGMVYLVGANTRAF 121 +A +A++ T ++G ++E AYRPLR + R+++LI+AIGVSFLLE ++ +G +F Sbjct: 64 PLAFGLALILTGLMGAMLERGAYRPLRRAPRLSLLISAIGVSFLLENLVLVFIGGRPLSF 123 Query: 122 P-QAIQTVRYDLGPISLTNVQLMILGISLILMILLQVIVQKTKMGKAMRAVSVDSDAAQL 180 P A + G + L + + I I+LI++ L V++ T++G A+RA++ D + Q+ Sbjct: 124 PTPAFFGGAWRFGELYLPRLSVYIPLITLIVLAGLFVLIYSTRVGMALRALAFDWETTQI 183 Query: 181 MGINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTPGLKSFVAAVLGGIGIIPG 240 MG+NVNR IS TF LGS LAG G+L A+ Y + P +G+ PGLK+FVAAVLGGIG +PG Sbjct: 184 MGVNVNRLISLTFILGSTLAGVGGLLWAMKYPQVNPFLGILPGLKAFVAAVLGGIGSLPG 243 Query: 241 AALGGFVIGLLETFATAF--GMSDFRDAIVYGILLLILIVRPAGILGK 286 A +GG ++GLLE A + +RDA+ +G+L+++L+VRP GI+G+ Sbjct: 244 AVVGGVLLGLLEITVVAVFPSWAGYRDALAFGLLIVVLLVRPTGIMGE 291 Lambda K H 0.330 0.146 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 298 Length adjustment: 26 Effective length of query: 266 Effective length of database: 272 Effective search space: 72352 Effective search space used: 72352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory