Align NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_013706792.1 DESAC_RS09200 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8YXD0 (288 letters) >NCBI__GCF_000195295.1:WP_013706792.1 Length = 287 Score = 147 bits (372), Expect = 2e-40 Identities = 89/281 (31%), Positives = 157/281 (55%), Gaps = 5/281 (1%) Query: 6 IQLIVNGIAVGSIIALAAVGLTLTYGILRLSNFAHGDFLTLGAYLT-FFVNTFGVNIWLS 64 +Q I+NG+ GS+ AL A+G T+ YGIL L NFA G+ GA+ ++ + VN +++ Sbjct: 3 LQQILNGLTAGSVYALIALGYTMIYGILGLINFAQGEIYMAGAFAAVLLLSAYQVNFFVA 62 Query: 65 MIVAVVGTVGVMLLSEKLLWSRMRSIRANSTTLIIISIGLALFLRNGIILIWGGRNQNYN 124 + + V V + E+ + +R A+ +I +IG ++ L++ +L++G ++++ Sbjct: 63 CLFGMGVAVLVGVALERFAFRPLRG--AHPLVPLISAIGASILLQSLALLLFGPEDRSFP 120 Query: 125 LPIT-PALDIFGVKVPQNQLLVLALAVLSIGALHYLLQNTKIGKAMRAVADDLDLAKVSG 183 ALD+ G + Q + A+ + L ++ T+ GKA+ A A D D A++ G Sbjct: 121 THFEFAALDVAGASISTLQAAIFISALFFMILLMVFVRYTRFGKAIVATALDQDTARLMG 180 Query: 184 IDVEQVIFWTWLIAGTVTSLGGSMYGLI-TAVRPNMGWFLILPLFASVILGGIGNPYGAI 242 I+V+++I T++I ++ G M + A P MG L F++ +LGG+GN GAI Sbjct: 181 INVDRMITLTFVIGSALSGAAGIMMAIYYNATYPRMGLLPGLKAFSAAVLGGVGNIPGAI 240 Query: 243 AAAFIIGIVQEVSTPFLGSQYKQGVALLIMILVLLIRPKGL 283 I+G+ + + +L S YK +A I+I+VLL+RP+GL Sbjct: 241 IGGLILGVAENLGAAYLSSGYKDAIAFAILIVVLLVRPRGL 281 Lambda K H 0.328 0.144 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 287 Length adjustment: 26 Effective length of query: 262 Effective length of database: 261 Effective search space: 68382 Effective search space used: 68382 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory