Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_013706792.1 DESAC_RS09200 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >NCBI__GCF_000195295.1:WP_013706792.1 Length = 287 Score = 254 bits (649), Expect = 2e-72 Identities = 138/294 (46%), Positives = 190/294 (64%), Gaps = 12/294 (4%) Query: 7 YLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLD 66 +LQQ++NGLT GS YALIA+GYTM+YGI+G+INFA GE+YM G AF A+ LL+ Sbjct: 2 FLQQILNGLTAGSVYALIALGYTMIYGILGLINFAQGEIYMAG---AFAAVLLLSAY--- 55 Query: 67 SVPLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNAVMLSQD 126 V + F + V G ++ER A+RPLRG + L+PLISAIG SI LQ+ +L Sbjct: 56 QVNFFVACLFGMGVAVL--VGVALERFAFRPLRGAHPLVPLISAIGASILLQSLALLLFG 113 Query: 127 SKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRACRAC 186 ++++ PT +F F + G IS +Q IF+ M L +F+ +R G+A A Sbjct: 114 PEDRSFPT----HFEFAALDVAGASISTLQAAIFISALFFMILLMVFVRYTRFGKAIVAT 169 Query: 187 AEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKAFTAAV 246 A D L+GIN + +I LTFVIG+AL+ A +++ + Y P +G L G+KAF+AAV Sbjct: 170 ALDQDTARLMGINVDRMITLTFVIGSALSGAAGIMMAIYYNATYPRMGLLPGLKAFSAAV 229 Query: 247 LGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPTGILG 300 LGG+G+IPGA++GGL+LGVAE GA YKD +AF +LI+VLL RP G+LG Sbjct: 230 LGGVGNIPGAIIGGLILGVAENLGAAYLSSGYKDAIAFAILIVVLLVRPRGLLG 283 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 287 Length adjustment: 26 Effective length of query: 281 Effective length of database: 261 Effective search space: 73341 Effective search space used: 73341 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory