Align 2-methylbutanoyl-CoA dehydrogenase / butanoyl-CoA dehydrogenase / isobutyryl-CoA dehydrogenase (EC 1.3.8.1; EC 1.3.8.5) (characterized)
to candidate WP_013705547.1 DESAC_RS02715 acyl-CoA dehydrogenase family protein
Query= reanno::pseudo3_N2E3:AO353_25680 (375 letters) >NCBI__GCF_000195295.1:WP_013705547.1 Length = 385 Score = 304 bits (779), Expect = 2e-87 Identities = 162/375 (43%), Positives = 241/375 (64%), Gaps = 2/375 (0%) Query: 2 LPTDEQLQISDAARQFAQERLKPFAAEWDREHRFPKEAIGEMAELGFFGMLVPEQWGGCD 61 L T+EQ + + A Q A +R+KP AE D FP E + ++A+ FG+++PEQ+GG Sbjct: 4 LLTEEQQMLQELALQIAHDRIKPVRAELDEHEIFPTELMRDLAQADLFGVIIPEQYGGLG 63 Query: 62 TGYLAYAMALEEIAAGDGACSTIMSVHNSVGCVPILKFGNDDQKERFLKPLASGAMLGAF 121 G + + LE ++ G +T + +G P L +G++DQK+R+L PLA G L AF Sbjct: 64 LGCMENCLVLEALSTGCVGIATTFAA-TFLGAYPFLLYGSEDQKKRYLPPLAKGDHLAAF 122 Query: 122 ALTEPQAGSDASSLKTRARLNGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISA 181 ALTE QAGSDA +++T A +GD Y+LNG KQ+IT+ AG+ V A++D S G RG SA Sbjct: 123 ALTESQAGSDAGAIQTIAVRDGDSYILNGTKQWITNAGEAGIYTVIALSDRSKGARGASA 182 Query: 182 FIVPTDSPGYKVARVEDKLGQHASDTCQILFEDVQVPVANRLGEEGEGYKIALANLEGGR 241 FIV D PG + E K+G AS T +I+F++ ++P + +EG G+ IAL L+ R Sbjct: 183 FIVEADDPGISFGKKEQKMGIRASVTREIVFQNCRIPANRLIAKEGFGFVIALKTLDFSR 242 Query: 242 VGIASQSVGMARAAFEAARDYARERESFGKPIIEHQAVAFRLADMATQIAVARQMVH-YA 300 G+ + ++G+A+AA E A +ARER+ FG PII QAV LA+MATQ+ AR +V+ A Sbjct: 243 PGVGALALGLAQAALEEAVIFARERQQFGHPIISFQAVQHMLANMATQLEAARALVYAVA 302 Query: 301 AALRDSGKPALVEASMAKLFASEMAEKVCSTALQTLGGYGYLSDFPLERIYRDVRVCQIY 360 A+ K E++MAKLF ++MA +V + A+Q LGG+GY+ ++P+E++ RD ++ QI+ Sbjct: 303 RAIDHDPKEFSKESAMAKLFPTDMAMQVTTDAVQILGGHGYMREYPVEKMMRDAKILQIF 362 Query: 361 EGTSDIQRMVISRNL 375 EGT+ I R VI + L Sbjct: 363 EGTNQILRNVIGQAL 377 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 385 Length adjustment: 30 Effective length of query: 345 Effective length of database: 355 Effective search space: 122475 Effective search space used: 122475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory