Align Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE; KDG aldolase YagE; Putative 2-dehydro-3-deoxy-D-pentonate aldolase YagE; EC 4.1.2.51; EC 4.1.2.28 (characterized)
to candidate WP_013707419.1 DESAC_RS12395 4-hydroxy-tetrahydrodipicolinate synthase
Query= SwissProt::P75682 (302 letters) >NCBI__GCF_000195295.1:WP_013707419.1 Length = 290 Score = 142 bits (357), Expect = 1e-38 Identities = 96/290 (33%), Positives = 144/290 (49%), Gaps = 10/290 (3%) Query: 6 LFTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIA 65 + G I + T F DGQLD+ LI+ I G G+ G+ GE + L E K + Sbjct: 1 MIQGAIVAIVTPFK-DGQLDEETYRELIEFQIAGGTHGIVPCGTTGESATLSHHEHKRVV 59 Query: 66 RFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFE 125 I+ V +RVPV+ GTG N E +EL++HAQ AGAD ++I PYY K ++ L ++++ Sbjct: 60 EICIEQVKKRVPVIAGTGSNNTAEAVELTKHAQSAGADAALMITPYYNKPTQEGLYQHYK 119 Query: 126 QVADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTVKG 185 +A++ +P+++YN P T +L P V LA NIIGIK ++ L ++ Sbjct: 120 AIAEATHIPIIVYNVPGRTSLNLLPETVARLA-KLPNIIGIK---EATGDLNQGARVIRL 175 Query: 186 AHPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQTL 245 +F VL G D + LGG G IS N P + A+ G++ A H + Sbjct: 176 CPENFIVLSGDDFTALPLMCLGGRGVISVISNVVPDDMAGMCNAFLSGNLGTARSLHYKM 235 Query: 246 LQIPQMYQLDTPFVNVIKEAIVLCGRPVSTHVLPP---ASPLDEPRKAQL 292 + + +T V K A+ L GR +S V P SP +E R Q+ Sbjct: 236 WPLMEAMFFETNPVPA-KTALKLMGR-ISGEVRLPLCNMSPANEERLRQV 283 Lambda K H 0.320 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 290 Length adjustment: 26 Effective length of query: 276 Effective length of database: 264 Effective search space: 72864 Effective search space used: 72864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory