Protein WP_011317597.1 in Trichormus variabilis ATCC 29413
Annotation: NCBI__GCF_000204075.1:WP_011317597.1
Length: 381 amino acids
Source: GCF_000204075.1 in NCBI
Candidate for 33 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-asparagine catabolism | natH | hi | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) | 97% | 100% | 726.9 | ABC transporter for D-Alanine, permease component 1 | 39% | 256.9 |
| L-aspartate catabolism | natH | hi | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) | 97% | 100% | 726.9 | ABC transporter for D-Alanine, permease component 1 | 39% | 256.9 |
| L-histidine catabolism | aapM | med | ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 (characterized) | 40% | 92% | 253.1 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| D-alanine catabolism | Pf6N2E2_5404 | lo | ABC transporter for D-Alanine, permease component 1 (characterized) | 39% | 94% | 256.9 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-asparagine catabolism | aapM | lo | AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 44% | 67% | 228 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-aspartate catabolism | aapM | lo | AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 44% | 67% | 228 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-glutamate catabolism | aapM | lo | AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 44% | 67% | 228 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-leucine catabolism | aapM | lo | AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 44% | 67% | 228 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-proline catabolism | aapM | lo | AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 44% | 67% | 228 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-asparagine catabolism | bztC | lo | BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 37% | 94% | 227.3 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-aspartate catabolism | bztC | lo | BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 37% | 94% | 227.3 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-glutamate catabolism | bztC | lo | BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 37% | 94% | 227.3 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-asparagine catabolism | aatM | lo | ABC transporter for L-Asparagine and possibly other L-amino acids, permease component 2 (characterized) | 33% | 96% | 128.3 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-aspartate catabolism | aatM | lo | ABC transporter for L-Asparagine and possibly other L-amino acids, permease component 2 (characterized) | 33% | 96% | 128.3 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-glutamate catabolism | gltK | lo | PP1069, component of Acidic amino acid uptake porter, AatJMQP (characterized) | 33% | 96% | 127.5 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-asparagine catabolism | peb1D | lo | Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) | 34% | 90% | 122.9 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-aspartate catabolism | peb1D | lo | Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) | 34% | 90% | 122.9 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| D-glucosamine (chitosamine) catabolism | AO353_21720 | lo | ABC transporter for D-glucosamine, permease component 2 (characterized) | 33% | 92% | 119.4 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-asparagine catabolism | peb1B | lo | PEP1B, component of Uptake system for glutamate and aspartate (characterized) | 30% | 80% | 117.1 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-aspartate catabolism | peb1B | lo | PEP1B, component of Uptake system for glutamate and aspartate (characterized) | 30% | 80% | 117.1 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-glutamate catabolism | peb1B | lo | PEP1B, component of Uptake system for glutamate and aspartate (characterized) | 30% | 80% | 117.1 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| D-glucosamine (chitosamine) catabolism | AO353_21715 | lo | ABC transporter for D-Glucosamine, permease component 2 (characterized) | 34% | 92% | 116.7 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-histidine catabolism | Ac3H11_2554 | lo | ABC transporter for L-Histidine, permease component 1 (characterized) | 33% | 91% | 114.4 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-lysine catabolism | hisM | lo | ABC transporter for L-Lysine, permease component 2 (characterized) | 34% | 95% | 111.3 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-asparagine catabolism | natG | lo | NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) | 30% | 74% | 105.5 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-aspartate catabolism | natG | lo | NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) | 30% | 74% | 105.5 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-arginine catabolism | artM | lo | AotP aka AotM aka PA0890, component of Arginine/ornithine (but not lysine) porter (characterized) | 34% | 89% | 103.6 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-citrulline catabolism | AO353_03045 | lo | ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized) | 33% | 85% | 100.1 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-lysine catabolism | hisQ | lo | ABC transporter for L-Lysine, permease component 1 (characterized) | 30% | 95% | 90.5 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-asparagine catabolism | bztB | lo | glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized) | 32% | 52% | 90.1 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-aspartate catabolism | bztB | lo | glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized) | 32% | 52% | 90.1 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-glutamate catabolism | bztB | lo | glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized) | 32% | 52% | 90.1 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
| L-histidine catabolism | hisM | lo | Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) | 31% | 92% | 89.7 | NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB | 97% | 726.9 |
Sequence Analysis Tools
View WP_011317597.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MIKLTWLRKNLFSTWYNSLLTVICSALLLWLVQGIVIWATTKAQWAVVQVNLRLFLVGRF
PQTEYWRVWIVLAIASTLGAVTAGVFFNQQKLTWRKVGLFAFIVGLLLVLFPLDLSSRLW
LLLTAILLIPGFILGSKLTNLVAPWLSLIWLLSFPIILWLIGGGFGLRPVSSNLWNGLLL
TLLMAAISIVLSFPIGVLLALGRTSNLPVVRWFSILYIEIIRGVPLIGILFLAQVMLPLF
FAADVRLDRVLRAIAGLVLFSAAYMAENVRGGLQAVSRGQVEAAKALGLNTFFVVLLIVL
PQALRAVIPAVVGQFIGLFKDTSLLSLVGLVELTGIARSILAQPQFIGRYAEVYLFIGLI
YWLFCYSMSLASRRLERQLNN
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory