Align High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale)
to candidate WP_011318451.1 AVA_RS08305 LPS export ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWS6 (255 letters) >NCBI__GCF_000204075.1:WP_011318451.1 Length = 242 Score = 127 bits (320), Expect = 2e-34 Identities = 79/250 (31%), Positives = 137/250 (54%), Gaps = 19/250 (7%) Query: 8 VENLSMRFGGLLAVNGVALTVKEKQVVALIGPNGAGKTTVFNCLTGFYQPTGGTILLDGE 67 +EN+ +G + VN V L+V + ++V L+GPNGAGKTT F TG +P G + LD Sbjct: 5 LENIHKSYGKRVIVNRVNLSVAQGEIVGLLGPNGAGKTTTFYIATGLEKPNQGRVWLDSL 64 Query: 68 PIQGLPGHHIARKGVVRTFQNVRLFKDMTAVENLLIAQHRHLNTNFFAGLFKTPAFRKSE 127 I GLP H AR G+ Q +F+ ++ +N+L+ + TN P + ++ Sbjct: 65 DITGLPMHKRARLGIGYLAQEASVFRQLSVQDNILLVFEQ---TN-------VPRWEWAK 114 Query: 128 REAMEYAEYWLDKVNLTEFANRPAGTLAYGQQRRLEIARCMMT---RPRILMLDEPAAGL 184 R E+ L+KV A L+ G++RR E+AR + P+ L LDEP AG+ Sbjct: 115 RLNTLLREFRLEKV-----AKSKGIQLSGGERRRTELARALAAGGEGPKFLFLDEPFAGV 169 Query: 185 NPKETEDLKALIGVLREEHNVTVLLIEHDMKLVMSISDHIVVINQGTPLADGTPEQIRDN 244 +P +++ ++ LR + + +L+ +H+++ ++I+D ++ +G LA G +++ +N Sbjct: 170 DPIAVFEIQQIVAQLR-DRGMGILITDHNVRETLAITDRAYILREGQILAYGNADELYNN 228 Query: 245 PEVIKAYLGE 254 P V + YLG+ Sbjct: 229 PLVRQYYLGD 238 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 242 Length adjustment: 24 Effective length of query: 231 Effective length of database: 218 Effective search space: 50358 Effective search space used: 50358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory