Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_041456588.1 AVA_RS02390 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000204075.1:WP_041456588.1 Length = 248 Score = 135 bits (341), Expect = 6e-37 Identities = 85/248 (34%), Positives = 136/248 (54%), Gaps = 15/248 (6%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 +L++ + +GG+QAL + +TI++G+V LIG NGAGK+T I+ + TP G Sbjct: 16 ILEIQELDVNYGGIQALKKINLTIQKGEVVTLIGANGAGKSTTLRAISKIVTPKNGQIIY 75 Query: 69 AGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFK 128 +G+ HEV K GIA + R+ A+ T L+N+++G +IR F K Sbjct: 76 SGRNITRRLPHEVVKFGIAHCPEGRRVLAKQTVLDNLLLGAYIR---------FNQTEIK 126 Query: 129 AEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGM 188 A+ K+ EL + + + + A TLS G+Q+ L IARAL + PQL+ LDEP+ G+ Sbjct: 127 AD----IKQQFEL--FPRLAQRQNQLAGTLSGGEQQMLAIARALMSRPQLLLLDEPSLGL 180 Query: 189 NATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNE 248 ++ +I+ +R TILL+E + L + + DR VL+ G G + + +E Sbjct: 181 APAIVKEIFSIIENLRATGVTILLVEQNANLALQIADRGYVLEAGSITLSGAASNLINDE 240 Query: 249 KVIEAYLG 256 +V +AYLG Sbjct: 241 RVKKAYLG 248 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 248 Length adjustment: 24 Effective length of query: 236 Effective length of database: 224 Effective search space: 52864 Effective search space used: 52864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory