Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate WP_011317392.1 AVA_RS02615 acetyl-CoA carboxylase biotin carboxylase subunit
Query= metacyc::MONOMER-13597 (509 letters) >NCBI__GCF_000204075.1:WP_011317392.1 Length = 447 Score = 407 bits (1045), Expect = e-118 Identities = 215/445 (48%), Positives = 295/445 (66%), Gaps = 3/445 (0%) Query: 4 FSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYL 63 F ++L+ANRGEIA R+L+A +EMG+ IAV+S D+ A+H + ADEA IG+ + SYL Sbjct: 3 FDKILIANRGEIALRILRACEEMGIATIAVHSTVDRNALHVQLADEAVCIGEPASAKSYL 62 Query: 64 NIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDGKR 123 NI +II AA + AIHPGYGFLSENA+FAE I FIGP+ E +R + DK K Sbjct: 63 NIPNIIAAALTRNASAIHPGYGFLSENAKFAEICADHHIAFIGPTPEAIRLMGDKSTAKE 122 Query: 124 LANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMDVW 183 AGVPT PGS+G V + E L+LA+ IGYP+M+KA +GGGG G+ V + D+ + ++ Sbjct: 123 TMQKAGVPTVPGSEGLVETEQEGLELAKDIGYPVMIKATAGGGGRGMRLVRSPDEFVKLF 182 Query: 184 ERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLIEE 243 + A AFG A ++IEK+ PRHIEFQ++ D YGN + ER+C+IQRRNQKL+EE Sbjct: 183 LAAQGEAGAAFGNAGVYIEKFIERPRHIEFQILADSYGNVIHLGERDCSIQRRNQKLLEE 242 Query: 244 APSPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEHPTT 303 APSPAL + RE M + +K + INY GT E D S FYF+E+N R+QVEHP T Sbjct: 243 APSPALDSDLREKMGQAAVKAAQFINYTGAGTIEFLL-DRSGQFYFMEMNTRIQVEHPVT 301 Query: 304 ELIFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFVTYY 363 E++ +DL+ QI++A GE L +Q+ + +RG AIE RINAED ++F + G ++ Y Sbjct: 302 EMVTGVDLLVEQIRIAQGERLRLTQDQV--VLRGHAIECRINAEDPDHDFRPAPGRISGY 359 Query: 364 REPTGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKIGGIKTT 423 P GPGVR+DS + + +PPYYDSL+ KLIV+G R AI RAL + I G+ TT Sbjct: 360 LPPGGPGVRIDSHVYTDYQIPPYYDSLIGKLIVWGPDRATAINRMKRALRECAITGLPTT 419 Query: 424 IELYKWIMQDPDFQEGKFSTSYISQ 448 I ++ IM++ F +G STS++ + Sbjct: 420 IGFHQRIMENTQFLQGNVSTSFVQE 444 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 543 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 447 Length adjustment: 33 Effective length of query: 476 Effective length of database: 414 Effective search space: 197064 Effective search space used: 197064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory