GapMind for catabolism of small carbon sources

 

Protein WP_013519272.1 in Alicycliphilus denitrificans K601

Annotation: NCBI__GCF_000204645.1:WP_013519272.1

Length: 375 amino acids

Source: GCF_000204645.1 in NCBI

Candidate for 48 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA med spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 42% 86% 252.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
sucrose catabolism thuK med ABC transporter (characterized, see rationale) 41% 82% 247.7 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-mannitol catabolism mtlK med SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 44% 80% 226.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 42% 74% 224.6 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 41% 82% 223.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-sorbitol (glucitol) catabolism mtlK med MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 41% 80% 223.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 41% 78% 221.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
trehalose catabolism thuK med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 41% 78% 221.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 42% 72% 219.9 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 44% 70% 219.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 44% 70% 219.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 42% 73% 218.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 79% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-maltose catabolism thuK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 79% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 79% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 79% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 41% 75% 210.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 40% 82% 205.7 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 40% 75% 191 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 38% 92% 224.2 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 39% 79% 223.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-cellobiose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 36% 93% 221.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-glucose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 36% 93% 221.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
lactose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 36% 93% 221.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-maltose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 36% 93% 221.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
sucrose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 36% 93% 221.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
trehalose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 36% 93% 221.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 39% 80% 218.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 43% 65% 213.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 34% 93% 213.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 43% 64% 212.2 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 35% 80% 202.2 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 78% 199.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 78% 199.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 78% 199.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 78% 199.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 78% 199.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 78% 199.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 95% 192.6 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 95% 192.6 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 95% 192.6 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 95% 192.6 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
L-proline catabolism opuBA lo BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 35% 94% 178.7 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 37% 60% 174.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 32% 94% 163.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 37% 84% 162.9 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 37% 87% 161.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 37% 77% 137.9 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 353.6

Sequence Analysis Tools

View WP_013519272.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSIEIRNVSKQFGSFQALRDVSLDIQSGELIALLGPSGCGKTTLLRIIAGLETPDTGSIH
FSGENQTDVHVRERGVGFVFQHYALFRHMTVLDNVAFGLRMKPRRERPSEAQIRQKVMDL
LKLVQLDWIADRYPSQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRKELRRWLR
RLHDELHVTSIFVTHDQEEALEVADRVVVINQGRIEQQGTPQQVWDNPASPFVYGFLGDV
NLFKGRANDGRIHLDEGMQLDSPEARHADGAPAFAYVRPHDLDVERYSPGQALDAHGRPR
GIVVQLVRSIVVGPIARLELIPEGSTQSADNAAPDMLIEAQIPAQQFHDMGLRDGEMLVV
TPRRAKVFLDEAAGI

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory