GapMind for catabolism of small carbon sources

 

Protein WP_013722875.1 in Alicycliphilus denitrificans K601

Annotation: NCBI__GCF_000204645.1:WP_013722875.1

Length: 353 amino acids

Source: GCF_000204645.1 in NCBI

Candidate for 16 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA med spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 44% 79% 229.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 41% 98% 223.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 40% 83% 216.5 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
D-cellobiose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 38% 91% 223.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
D-glucose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 38% 91% 223.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
lactose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 38% 91% 223.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
D-maltose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 38% 91% 223.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
sucrose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 38% 91% 223.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
trehalose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 38% 91% 223.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 38% 91% 223.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 91% 219.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 39% 96% 218 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 39% 91% 208.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
glycerol catabolism glpT lo ABC transporter for Glycerol, ATPase component 2 (characterized) 37% 82% 172.6 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 39% 85% 159.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 39% 85% 159.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 39% 239.6

Sequence Analysis Tools

View WP_013722875.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MELERIPVEIDHCSKTYADGTRGLQPTSLHVEPGEVLALLGPSGCGKTTLLRLIAGLETL
DPGGRILFGEQDVTHRPVEQRGVGMVFQSYALFPQMSVAANIGYGLRIRGVSAAEERRAV
GELVELTRLTGLEAKRPGELSGGQRQRVALARAVAVRPRVLLLDEPLAALDAKLKEQLRE
ELAELLRRLHITAIHVTHDQQESMAIADRLAVMRAGSIVQVGHGEDLYRAPAHPFVAEFL
GRVNRIERSPESLARGVLTIGGATLTCPPALDQSALLVRPEDIQIGPRQDGWGVARVEQR
SFLGDRVQLRLSAAGVPGTLLADAARDTPYRSGDEVGIRIDPQRLMSTAEASA

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory