Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate WP_013519272.1 ALIDE2_RS13080 sulfate ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc04256 (361 letters) >NCBI__GCF_000204645.1:WP_013519272.1 Length = 375 Score = 202 bits (514), Expect = 1e-56 Identities = 113/260 (43%), Positives = 159/260 (61%), Gaps = 8/260 (3%) Query: 3 SVSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQIFI 62 S+ +R++S FG+ L ++LDI GE + LLG SGCGK+TLL IAGL G I Sbjct: 2 SIEIRNVSKQFGSFQALRDVSLDIQSGELIALLGPSGCGKTTLLRIIAGLETPDTGSIHF 61 Query: 63 KDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVA----KIPPAEIEKRVKRAS 118 N T ++RG+G VFQ YAL+ MTV N++FGL++ + A+I ++V Sbjct: 62 SGENQTDVHVRERGVGFVFQHYALFRHMTVLDNVAFGLRMKPRRERPSEAQIRQKVMDLL 121 Query: 119 EILQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKR 178 +++Q+ + R PS+LSGGQRQR+A+ RAL + V L DEP LDAK+R ELR ++R Sbjct: 122 KLVQLDWIADRYPSQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRKELRRWLRR 181 Query: 179 LHQSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPS 238 LH L T I+VTHDQ EAL +ADR+ V+ G I+Q P +++ P + FV GF+G Sbjct: 182 LHDELHVTSIFVTHDQEEALEVADRVVVINQGRIEQQGTPQQVWDNPASPFVYGFLG--D 239 Query: 239 MNFFRGEVEPKDGRSFVRAG 258 +N F+G DGR + G Sbjct: 240 VNLFKGRA--NDGRIHLDEG 257 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 375 Length adjustment: 30 Effective length of query: 331 Effective length of database: 345 Effective search space: 114195 Effective search space used: 114195 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory