Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_013518270.1 ALIDE2_RS17550 aspartate aminotransferase family protein
Query= BRENDA::O30508 (406 letters) >NCBI__GCF_000204645.1:WP_013518270.1 Length = 398 Score = 269 bits (688), Expect = 9e-77 Identities = 153/366 (41%), Positives = 215/366 (58%), Gaps = 11/366 (3%) Query: 30 RGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRIWHVSNVFTNEPALRL 89 RG+G RVWD +G++ +D GGIAV +LGH HP LV AL EQ ++ H SN + L Sbjct: 25 RGQGVRVWDVNGKQYLDGLGGIAVNTLGHNHPRLVPALQEQIAKLIHTSNYYHVPGQEEL 84 Query: 90 ARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYGPQKYEIIAASNSFHGRTLFTV 149 AR L F N+G EANE A K+AR+Y D G +K EI+ ++FHGR++ T+ Sbjct: 85 ARLLTGRARMTNAFFCNTGLEANECAIKIARKYGVDK-GIEKPEIVVYDHAFHGRSIATM 143 Query: 150 NVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAI--SDKTCAVVLEPIQGEGGVLPAQQA 207 G PK +GFGP EG V ND+EAL+ A + AV++EPIQGEGG+ P + Sbjct: 144 TATGNPKVRNGFGPLLEGFIRVAPNDIEALQEATEGNPNVVAVLMEPIQGEGGLHPMRVE 203 Query: 208 YLEGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDILSSAKSLGGGFPIGAML 267 YL+ RKLCD + LL+ DEVQ+GMGR G+ FA+ G+VPD+++ AK LG G P+GA+L Sbjct: 204 YLQQVRKLCDANGWLLMLDEVQAGMGRTGKWFAHQWAGIVPDVMTLAKGLGSGVPVGAVL 263 Query: 268 TTGEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKAKHERFKSRLQK-IG 326 G ++ L G HG+T+GGNPLA + ++ +L K+ LQ+ +G Sbjct: 264 AHGAASEVLKPGNHGSTFGGNPLAMRAGVETIRIMEEEGLLQNAADVGAHLKAGLQQALG 323 Query: 327 QEYGIFDEIRGMGLLIGAALTDEWKGKARDVLNAAEKEAVMVLQASPD-VVRFAPSLVID 385 G+ +E+RG GL+IG L + VL +A ++L + D V+R P+L + Sbjct: 324 SVPGV-NEVRGQGLIIGVEL-----DRPCGVLIDRAAQAGLLLSVTADRVIRLVPALTLT 377 Query: 386 DAEIDE 391 AE DE Sbjct: 378 RAEADE 383 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 398 Length adjustment: 31 Effective length of query: 375 Effective length of database: 367 Effective search space: 137625 Effective search space used: 137625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory